AMPDB_250 | Penaeidin-3a

1 General Description

AMPDB ID: AMPDB_250

Protein Names: Penaeidin-3a (P3-a) (Pen-3a)

Protein Family: Penaeidin family

Gene Name: Nil

Source Organism: Penaeus vannamei (Whiteleg shrimp) (Litopenaeus vannamei)

Protein Length: 82 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MRLVVCLVFLASFALVCQGQVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGCPVSCRGISFSQARSCCSRLGRCCHVGKGYSG

FASTA format

Counts of Amino Acids

'A': 3, 'R': 8, 'N': 1, 'D': 0, 'C': 8, 'Q': 3, 'E': 0, 'G': 12, 'H': 1, 'I': 3, 'L': 6, 'K': 2, 'M': 1, 'F': 4, 'P': 10, 'S': 7, 'T': 1, 'W': 0, 'Y': 4, 'V': 8

Frequencies of Amino Acids

'A': 3.66%, 'R': 9.76%, 'N': 1.22%, 'D': 0%, 'C': 9.76%, 'Q': 3.66%, 'E': 0%, 'G': 14.63%, 'H': 1.22%, 'I': 3.66%, 'L': 7.32%, 'K': 2.44%, 'M': 1.22%, 'F': 4.88%, 'P': 12.2%, 'S': 8.54%, 'T': 1.22%, 'W': 0%, 'Y': 4.88%, 'V': 9.76%

Missing Amino Acid(s)

D, E, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M, N, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8748.39 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	74.756	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	42.259	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.184	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.658	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.773	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	9.589	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.305, 0.366, 0.122 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.098	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5960, 6460	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

E.coli (Gram-negative), M.luteus (Gram-negative), N.crassa

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Destoumieux D, Bulet P, Loew D, et al. Penaeidins, a new family of antimicrobial peptides isolated from the shrimp Penaeus vannamei (Decapoda). J Biol Chem. 1997;272(45):28398-406. Published 1997 Nov 7. doi:10.1074/jbc.272.45.28398

PMID: 9353298

Citation 2: Cuthbertson BJ, Shepard EF, Chapman RW, et al. Diversity of the penaeidin antimicrobial peptides in two shrimp species. Immunogenetics. 2002;54(6):442-5. Published 2002 Sep. doi:10.1007/s00251-002-0487-z

PMID: 12242595

Citation 3: Destoumieux D, Bulet P, Strub JM, et al. Recombinant expression and range of activity of penaeidins, antimicrobial peptides from penaeid shrimp. Eur J Biochem. 1999;266(2):335-46. Published 1999 Dec. doi:10.1046/j.1432-1327.1999.00855.x

PMID: 10561573

Citation 4: Destoumieux D, MuÃ±oz M, Cosseau C, et al. Penaeidins, antimicrobial peptides with chitin-binding activity, are produced and stored in shrimp granulocytes and released after microbial challenge. J Cell Sci. 2000;113 ( Pt 3):461-9. Published 2000 Feb. doi:10.1242/jcs.113.3.461

PMID: 10639333

Citation 5: Destoumieux D, Munoz M, Bulet P, et al. Penaeidins, a family of antimicrobial peptides from penaeid shrimp (Crustacea, Decapoda). Cell Mol Life Sci. 2000;57(8-9):1260-71. Published 2000 Aug. doi:10.1007/pl00000764

PMID: 11028917

Citation 6: Yang Y, Poncet J, Garnier J, et al. Solution structure of the recombinant penaeidin-3, a shrimp antimicrobial peptide. J Biol Chem. 2003;278(38):36859-67. Published 2003 Sep 19. doi:10.1074/jbc.M305450200

PMID: 12842879

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P81058

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	Y14926	GenBank \|\| EMBL
2.	AF387661	GenBank \|\| EMBL
3.	AF387662	GenBank \|\| EMBL
4.	AF387663	GenBank \|\| EMBL
5.	AF390139	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR009226

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download