AMPDB_246 | C-X-C motif chemokine 6

1 General Description

AMPDB ID: AMPDB_246

Protein Names: C-X-C motif chemokine 6 (Chemokine alpha 3) (CKA-3) (Granulocyte chemotactic protein 2) (GCP-2) (Small-inducible cytokine B6) [Cleaved into: Small-inducible cytokine B6; N-processed variant 1; Small-inducible cytokine B6; N-processed variant 2; Small-inducible cytokine B6; N-processed variant 3]

Protein Family: Intercrine alpha (chemokine CxC) family

Gene Name: CXCL6 GCP2 SCYB6

Source Organism: Homo sapiens (Human)

Protein Length: 114 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN

FASTA format

Counts of Amino Acids

'A': 10, 'R': 5, 'N': 4, 'D': 2, 'C': 5, 'Q': 4, 'E': 3, 'G': 8, 'H': 0, 'I': 3, 'L': 19, 'K': 10, 'M': 1, 'F': 2, 'P': 12, 'S': 10, 'T': 5, 'W': 0, 'Y': 0, 'V': 11

Frequencies of Amino Acids

'A': 8.77%, 'R': 4.39%, 'N': 3.51%, 'D': 1.75%, 'C': 4.39%, 'Q': 3.51%, 'E': 2.63%, 'G': 7.02%, 'H': 0%, 'I': 2.63%, 'L': 16.67%, 'K': 8.77%, 'M': 0.88%, 'F': 1.75%, 'P': 10.53%, 'S': 8.77%, 'T': 4.39%, 'W': 0%, 'Y': 0%, 'V': 9.65%

Missing Amino Acid(s)

H, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	11897.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	112.018	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	49.641	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.254	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.736	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.621	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	9.691	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.307, 0.298, 0.289 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.018	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 250	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Cytokine, Chemotaxis, Signal peptide, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Rovai LE, Herschman HR, Smith JB, et al. Cloning and characterization of the human granulocyte chemotactic protein-2 gene. J Immunol. 1997;158(11):5257-66. Published 1997 Jun 1. doi:

PMID: 9164944

Citation 2: Ota T, Suzuki Y, Nishikawa T, et al. Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004;36(1):40-5. Published 2004 Jan. doi:10.1038/ng1285

PMID: 14702039

Citation 3: Hillier LW, Graves TA, Fulton RS, et al. Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005;434(7034):724-31. Published 2005 Apr 7. doi:10.1038/nature03466

PMID: 15815621

Citation 4: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 5: Froyen G, Proost P, Ronsse I, et al. Cloning, bacterial expression and biological characterization of recombinant human granulocyte chemotactic protein-2 and differential expression of granulocyte chemotactic protein-2 and epithelial cell-derived neutrophil activating peptide-78 mRNAs. Eur J Biochem. 1997;243(3):762-9. Published 1997 Feb 1. doi:10.1111/j.1432-1033.1997.00762.x

PMID: 9057843

Citation 6: Proost P, Wuyts A, Conings R, et al. Human and bovine granulocyte chemotactic protein-2: complete amino acid sequence and functional characterization as chemokines. Biochemistry. 1993;32(38):10170-7. Published 1993 Sep 28. doi:10.1021/bi00089a037

PMID: 8399143

Citation 7: Proost P, De Wolf-Peeters C, Conings R, et al. Identification of a novel granulocyte chemotactic protein (GCP-2) from human tumor cells. In vitro and in vivo comparison with natural forms of GRO, IP-10, and IL-8. J Immunol. 1993;150(3):1000-10. Published 1993 Feb 1. doi:

PMID: 8423327

Citation 8: Linge HM, Collin M, Nordenfelt P, et al. The human CXC chemokine granulocyte chemotactic protein 2 (GCP-2)/CXCL6 possesses membrane-disrupting properties and is antibacterial. Antimicrob Agents Chemother. 2008;52(7):2599-607. Published 2008 Jul. doi:10.1128/AAC.00028-08

PMID: 18443119

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P80162

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	U83303	GenBank \|\| EMBL
2.	U81234	GenBank \|\| EMBL
3.	AK311981	GenBank \|\| EMBL
4.	AC108029	GenBank \|\| EMBL
5.	BC013744	GenBank \|\| EMBL
6.	Y08770	GenBank \|\| EMBL

CCDS: CCDS3560.1

RefSeq: NP_002984.1

5.5 Protein-Protein Interaction Databases

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

PANTHER: PTHR10179

PROSITE: PS00471

5.8 Genome Annotation Databases

Ensembl: ENSGT00940000162749

5.9 Phylogenomic Databases

GeneTree: ENSGT00940000162749

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

Download