AMPDB_242 | C-C motif chemokine 20

1 General Description

AMPDB ID: AMPDB_242

Protein Names: C-C motif chemokine 20 (Beta-chemokine exodus-1) (CC chemokine LARC) (Liver and activation-regulated chemokine) (Macrophage inflammatory protein 3 alpha) (MIP-3-alpha) (Small-inducible cytokine A20) [Cleaved into: CCL20(1-67); CCL20(1-64); CCL20(2-70)]

Protein Family: Intercrine beta (chemokine CC) family

Gene Name: CCL20 LARC MIP3A SCYA20

Source Organism: Homo sapiens (Human)

Protein Length: 96 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

FASTA format

Counts of Amino Acids

'A': 7, 'R': 3, 'N': 5, 'D': 3, 'C': 7, 'Q': 2, 'E': 3, 'G': 4, 'H': 3, 'I': 6, 'L': 14, 'K': 10, 'M': 3, 'F': 4, 'P': 2, 'S': 6, 'T': 5, 'W': 1, 'Y': 2, 'V': 6

Frequencies of Amino Acids

'A': 7.29%, 'R': 3.13%, 'N': 5.21%, 'D': 3.13%, 'C': 7.29%, 'Q': 2.08%, 'E': 3.13%, 'G': 4.17%, 'H': 3.13%, 'I': 6.25%, 'L': 14.58%, 'K': 10.42%, 'M': 3.13%, 'F': 4.17%, 'P': 2.08%, 'S': 6.25%, 'T': 5.21%, 'W': 1.04%, 'Y': 2.08%, 'V': 6.25%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10761.9 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	106.667	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	19.896	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.294	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.791	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.173	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.839	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.344, 0.177, 0.281 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.073	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	8480, 8855	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Cytokine, Anti-cancer, Chemotaxis, Signal peptide, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Rossi DL, Vicari AP, Franz-Bacon K, et al. Identification through bioinformatics of two new macrophage proinflammatory human chemokines: MIP-3alpha and MIP-3beta. J Immunol. 1997;158(3):1033-6. Published 1997 Feb 1. doi:

PMID: 9013939

Citation 2: Hieshima K, Imai T, Opdenakker G, et al. Molecular cloning of a novel human CC chemokine liver and activation-regulated chemokine (LARC) expressed in liver. Chemotactic activity for lymphocytes and gene localization on chromosome 2. J Biol Chem. 1997;272(9):5846-53. Published 1997 Feb 28. doi:10.1074/jbc.272.9.5846

PMID: 9038201

Citation 3: Hromas R, Gray PW, Chantry D, et al. Cloning and characterization of exodus, a novel beta-chemokine. Blood. 1997;89(9):3315-22. Published 1997 May 1. doi:

PMID: 9129037

Citation 4: Nelson RT, Boyd J, Gladue RP, et al. Genomic organization of the CC chemokine mip-3alpha/CCL20/larc/exodus/SCYA20, showing gene structure, splice variants, and chromosome localization. Genomics. 2001;73(1):28-37. Published 2001 Apr 1. doi:10.1006/geno.2001.6482

PMID: 11352563

Citation 5: Hillier LW, Graves TA, Fulton RS, et al. Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005;434(7034):724-31. Published 2005 Apr 7. doi:10.1038/nature03466

PMID: 15815621

Citation 6: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 7: Schutyser E, Struyf S, Menten P, et al. Regulated production and molecular diversity of human liver and activation-regulated chemokine/macrophage inflammatory protein-3 alpha from normal and transformed cells. J Immunol. 2000;165(8):4470-7. Published 2000 Oct 15. doi:10.4049/jimmunol.165.8.4470

PMID: 11035086

Citation 8: RÃ¶hrl J, Yang D, Oppenheim JJ, et al. Specific binding and chemotactic activity of mBD4 and its functional orthologue hBD2 to CCR6-expressing cells. J Biol Chem. 2010;285(10):7028-34. Published 2010 Mar 5. doi:10.1074/jbc.M109.091090

PMID: 20068036

Citation 9: Ito T, Carson WF 4th, Cavassani KA, et al. CCR6 as a mediator of immunity in the lung and gut. Exp Cell Res. 2011;317(5):613-9. Published 2011 Mar 10. doi:10.1016/j.yexcr.2010.12.018

PMID: 21376174

Citation 10: Caballero-Campo P, Buffone MG, Benencia F, et al. A role for the chemokine receptor CCR6 in mammalian sperm motility and chemotaxis. J Cell Physiol. 2014;229(1):68-78. Published 2014 Jan. doi:10.1002/jcp.24418

PMID: 23765988

Citation 11: Diao R, Fok KL, Chen H, et al. Deficient human Î²-defensin 1 underlies male infertility associated with poor sperm motility and genital tract infection. Sci Transl Med. 2014;6(249):249ra108. Published 2014 Aug 13. doi:10.1126/scitranslmed.3009071

PMID: 25122636

Citation 12: Hoover DM, Boulegue C, Yang D, et al. The structure of human macrophage inflammatory protein-3alpha /CCL20. Linking antimicrobial and CC chemokine receptor-6-binding activities with human beta-defensins. J Biol Chem. 2002;277(40):37647-54. Published 2002 Oct 4. doi:10.1074/jbc.M203907200

PMID: 12149255

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P78556

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	U77035	GenBank \|\| EMBL
2.	D86955	GenBank \|\| EMBL
3.	U64197	GenBank \|\| EMBL
4.	AC073065	GenBank \|\| EMBL
5.	BC020698	GenBank \|\| EMBL

5.5 Protein-Protein Interaction Databases

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

PANTHER: PTHR12015

PROSITE: PS00472

5.8 Genome Annotation Databases

Ensembl: ENSGT01060000248576

5.9 Phylogenomic Databases

GeneTree: ENSGT01060000248576

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

Download