AMPDB_241 | Aurein-2.5

1 General Description

AMPDB ID: AMPDB_241

Protein Names: Aurein-2.5

Protein Family: Frog skin active peptide (FSAP) family; Aurein subfamily

Gene Name: Nil

Source Organism: Ranoidea aurea (Green and golden bell frog) (Litoria aurea)

Protein Length: 72 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MAFLKKSLFLVLFLGLVSLSICEKEKRQNEEDEDENEAANHEEGSEEKRGLFDIVKKVVGAFGSLGKRNDLE

FASTA format

Counts of Amino Acids

'A': 4, 'R': 3, 'N': 4, 'D': 4, 'C': 1, 'Q': 1, 'E': 12, 'G': 6, 'H': 1, 'I': 2, 'L': 10, 'K': 8, 'M': 1, 'F': 5, 'P': 0, 'S': 5, 'T': 0, 'W': 0, 'Y': 0, 'V': 5

Frequencies of Amino Acids

'A': 5.56%, 'R': 4.17%, 'N': 5.56%, 'D': 5.56%, 'C': 1.39%, 'Q': 1.39%, 'E': 16.67%, 'G': 8.33%, 'H': 1.39%, 'I': 2.78%, 'L': 13.89%, 'K': 11.11%, 'M': 1.39%, 'F': 6.94%, 'P': 0%, 'S': 6.94%, 'T': 0%, 'W': 0%, 'Y': 0%, 'V': 6.94%

Missing Amino Acid(s)

P, T, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, H, M, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8129.21 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	90.694	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	44.215	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.475	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.785	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.545	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-4.952	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.306, 0.208, 0.375 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.069	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-biofilm, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Anti-cancer, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Chen T, Scott C, Tang L, et al. The structural organization of aurein precursor cDNAs from the skin secretion of the Australian green and golden bell frog, Litoria aurea. Regul Pept. 2005;128(1):75-83. Published 2005 May 15. doi:10.1016/j.regpep.2004.12.022

PMID: 15721491

Citation 2: Rozek T, Wegener KL, Bowie JH, et al. The antibiotic and anticancer active aurein peptides from the Australian Bell Frogs Litoria aurea and Litoria raniformis the solution structure of aurein 1.2. Eur J Biochem. 2000;267(17):5330-41. Published 2000 Sep. doi:10.1046/j.1432-1327.2000.01536.x

PMID: 10951191

Citation 3: Dennison SR, Morton LH, Shorrocks AJ, et al. A study on the interactions of Aurein 2.5 with bacterial membranes. Colloids Surf B Biointerfaces. 2009;68(2):225-30. Published 2009 Feb 1. doi:10.1016/j.colsurfb.2008.10.007

PMID: 19056250

Citation 4: Dennison SR, Morton LH, Phoenix DA, et al. Effect of amidation on the antimicrobial peptide aurein 2.5 from Australian southern bell frogs. Protein Pept Lett. 2012;19(6):586-91. Published 2012 Jun 1. doi:10.2174/092986612800494110

PMID: 22519529

Citation 5: Dennison SR, Harris F, Morton LH, et al. Antimicrobial activity of aurein 2.5 against yeasts. FEMS Microbiol Lett. 2013;346(2):140-5. Published 2013 Sep. doi:10.1111/1574-6968.12212

PMID: 23841919

Citation 6: Dennison SR, Morton LH, Harris F, et al. The interaction of aurein 2.5 with fungal membranes. Eur Biophys J. 2014;43(6-7):255-64. Published 2014 Jul. doi:10.1007/s00249-014-0959-8

PMID: 24728560

Citation 7: Manzo G, Ferguson PM, Hind CK, et al. Temporin L and aurein 2.5 have identical conformations but subtly distinct membrane and antibacterial activities. Sci Rep. 2019;9(1):10934. Published 2019 Jul 29. doi:10.1038/s41598-019-47327-w

PMID: 31358802

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P69019

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ850129	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275, IPR016322

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download