AMPDB_240 | SPbeta prophage-derived bacteriocin sublancin-168

1 General Description

AMPDB ID: AMPDB_240

Protein Names: SPbeta prophage-derived bacteriocin sublancin-168

Protein Family: Nil

Gene Name: sunA yolG BSU21480

Source Organism: Bacillus subtilis (strain 168)

Protein Length: 56 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MEKLFKEVKLEELENQKGSGLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR

FASTA format

Counts of Amino Acids

'A': 6, 'R': 2, 'N': 2, 'D': 0, 'C': 5, 'Q': 5, 'E': 5, 'G': 9, 'H': 0, 'I': 1, 'L': 6, 'K': 5, 'M': 1, 'F': 2, 'P': 0, 'S': 2, 'T': 1, 'W': 1, 'Y': 1, 'V': 2

Frequencies of Amino Acids

'A': 10.71%, 'R': 3.57%, 'N': 3.57%, 'D': 0%, 'C': 8.93%, 'Q': 8.93%, 'E': 8.93%, 'G': 16.07%, 'H': 0%, 'I': 1.79%, 'L': 10.71%, 'K': 8.93%, 'M': 1.79%, 'F': 3.57%, 'P': 0%, 'S': 3.57%, 'T': 1.79%, 'W': 1.79%, 'Y': 1.79%, 'V': 3.57%

Missing Amino Acid(s)

D, H, P

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

I, M, T, W, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5981.91 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	69.821	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	23.746	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.216	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.644	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.207	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.695	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.232, 0.232, 0.321 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.071	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	6990, 7240	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

B.cereus (Gram-positive), B.subtilis (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Paik SH, Chakicherla A, Hansen JN, et al. Identification and characterization of the structural and transporter genes for, and the chemical and biological properties of, sublancin 168, a novel lantibiotic produced by Bacillus subtilis 168. J Biol Chem. 1998;273(36):23134-42. Published 1998 Sep 4. doi:10.1074/jbc.273.36.23134

PMID: 9722542

Citation 2: Kunst F, Ogasawara N, Moszer I, et al. The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997;390(6657):249-56. Published 1997 Nov 20. doi:10.1038/36786

PMID: 9384377

Citation 3: Stepper J, Shastri S, Loo TS, et al. Cysteine S-glycosylation, a new post-translational modification found in glycopeptide bacteriocins. FEBS Lett. 2011;585(4):645-50. Published 2011 Feb 18. doi:10.1016/j.febslet.2011.01.023

PMID: 21251913

Citation 4: Oman TJ, Boettcher JM, Wang H, et al. Sublancin is not a lantibiotic but an S-linked glycopeptide. Nat Chem Biol. 2011;7(2):78-80. Published 2011 Feb. doi:10.1038/nchembio.509

PMID: 21196935

Citation 5: Dorenbos R, Stein T, Kabel J, et al. Thiol-disulfide oxidoreductases are essential for the production of the lantibiotic sublancin 168. J Biol Chem. 2002;277(19):16682-8. Published 2002 May 10. doi:10.1074/jbc.M201158200

PMID: 11872755

Citation 6: Dubois JY, Kouwen TR, Schurich AK, et al. Immunity to the bacteriocin sublancin 168 Is determined by the SunI (YolF) protein of Bacillus subtilis. Antimicrob Agents Chemother. 2009;53(2):651-61. Published 2009 Feb. doi:10.1128/AAC.01189-08

PMID: 19047653

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P68577

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF014938	GenBank \|\| EMBL
2.	AL009126	GenBank \|\| EMBL

5.5 Protein-Protein Interaction Databases

STRING: 224308.BSU21480

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR026479

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: bsu:BSU21480

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: BSUB:BSU21480-MON

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download