AMPDB_234 | Reactive oxygen species modulator 1

1 General Description

AMPDB ID: AMPDB_234

Protein Names: Reactive oxygen species modulator 1 (ROS modulator 1) (Epididymis tissue protein Li 175) (Glyrichin) (Mitochondrial targeting GxxxG motif protein) (MTGM) (Protein MGR2 homolog)

Protein Family: MGR2 family

Gene Name: ROMO1 C20orf52

Source Organism: Homo sapiens (Human)

Protein Length: 79 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC

FASTA format

Counts of Amino Acids

'A': 6, 'R': 5, 'N': 0, 'D': 1, 'C': 4, 'Q': 3, 'E': 1, 'G': 17, 'H': 0, 'I': 4, 'L': 3, 'K': 2, 'M': 10, 'F': 6, 'P': 3, 'S': 4, 'T': 4, 'W': 0, 'Y': 1, 'V': 5

Frequencies of Amino Acids

'A': 7.59%, 'R': 6.33%, 'N': 0%, 'D': 1.27%, 'C': 5.06%, 'Q': 3.8%, 'E': 1.27%, 'G': 21.52%, 'H': 0%, 'I': 5.06%, 'L': 3.8%, 'K': 2.53%, 'M': 12.66%, 'F': 7.59%, 'P': 3.8%, 'S': 5.06%, 'T': 5.06%, 'W': 0%, 'Y': 1.27%, 'V': 6.33%

Missing Amino Acid(s)

H, N, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, E, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8182.83 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	60.506	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	50.649	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.51	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.513	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.613	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	4.751	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.241, 0.304, 0.253 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.089	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1740	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

P.aeruginosa (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-tuberculosis, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Zhao J, Liu T, Jin SB, et al. The novel conserved mitochondrial inner-membrane protein MTGM regulates mitochondrial morphology and cell proliferation. J Cell Sci. 2009;122(Pt 13):2252-62. Published 2009 Jul 1. doi:10.1242/jcs.038513

PMID: 19535734

Citation 2: Li J, Liu F, Wang H, et al. Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins. Mol Cell Proteomics. 2010;9(11):2517-28. Published 2010 Nov. doi:10.1074/mcp.M110.001719

PMID: 20736409

Citation 3: Deloukas P, Matthews LH, Ashurst J, et al. The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001;414(6866):865-71. Published 2001 Dec 20-27. doi:10.1038/414865a

PMID: 11780052

Citation 4: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 5: Chung YM, Kim JS, Yoo YD, et al. A novel protein, Romo1, induces ROS production in the mitochondria. Biochem Biophys Res Commun. 2006;347(3):649-55. Published 2006 Sep 1. doi:10.1016/j.bbrc.2006.06.140

PMID: 16842742

Citation 6: Hwang IT, Chung YM, Kim JJ, et al. Drug resistance to 5-FU linked to reactive oxygen species modulator 1. Biochem Biophys Res Commun. 2007;359(2):304-10. Published 2007 Jul 27. doi:10.1016/j.bbrc.2007.05.088

PMID: 17537404

Citation 7: Na AR, Chung YM, Lee SB, et al. A critical role for Romo1-derived ROS in cell proliferation. Biochem Biophys Res Commun. 2008;369(2):672-8. Published 2008 May 2. doi:10.1016/j.bbrc.2008.02.098

PMID: 18313394

Citation 8: Chung YM, Lee SB, Kim HJ, et al. Replicative senescence induced by Romo1-derived reactive oxygen species. J Biol Chem. 2008;283(48):33763-71. Published 2008 Nov 28. doi:10.1074/jbc.M805334200

PMID: 18836179

Citation 9: Burkard TR, Planyavsky M, Kaupe I, et al. Initial characterization of the human central proteome. BMC Syst Biol. 2011;5:17. Published 2011 Jan 26. doi:10.1186/1752-0509-5-17

PMID: 21269460

Citation 10: Sha J, Zhao G, Chen X, et al. Antibacterial potential of hGlyrichin encoded by a human gene. J Pept Sci. 2012;18(2):97-104. Published 2012 Feb. doi:10.1002/psc.1421

PMID: 22083756

Citation 11: Van Damme P, Lasa M, Polevoda B, et al. N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. Proc Natl Acad Sci U S A. 2012;109(31):12449-54. Published 2012 Jul 31. doi:10.1073/pnas.1210303109

PMID: 22814378

Citation 12: Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, et al. N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015;15(14):2519-24. Published 2015 Jul. doi:10.1002/pmic.201400617

PMID: 25944712

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P60602

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AM397244	GenBank \|\| EMBL
2.	AM397245	GenBank \|\| EMBL
3.	AM397246	GenBank \|\| EMBL
4.	GU727625	GenBank \|\| EMBL
5.	AL357374	GenBank \|\| EMBL
6.	CH471077	GenBank \|\| EMBL
7.	CH471077	GenBank \|\| EMBL
8.	BC008488	GenBank \|\| EMBL
9.	BC105281	GenBank \|\| EMBL

5.5 Protein-Protein Interaction Databases

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR018450

PANTHER: PTHR28525

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: ENSGT00390000005315

KEGG: hsa:140823

5.9 Phylogenomic Databases

GeneTree: ENSGT00390000005315

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

Download