AMPDB_230 | Neutrophil defensin 3

1 General Description

AMPDB ID: AMPDB_230

Protein Names: Neutrophil defensin 3 (Defensin; alpha 3) (HNP-3) (HP-3) (HP3) [Cleaved into: HP 3-56; Neutrophil defensin 2 (HNP-2) (HP-2) (HP2)]

Protein Family: Alpha-defensin family

Gene Name: DEFA3 DEF3

Source Organism: Homo sapiens (Human)

Protein Length: 94 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC

FASTA format

Counts of Amino Acids

'A': 18, 'R': 7, 'N': 1, 'D': 4, 'C': 6, 'Q': 5, 'E': 6, 'G': 4, 'H': 1, 'I': 7, 'L': 9, 'K': 2, 'M': 2, 'F': 1, 'P': 6, 'S': 3, 'T': 2, 'W': 2, 'Y': 3, 'V': 5

Frequencies of Amino Acids

'A': 19.15%, 'R': 7.45%, 'N': 1.06%, 'D': 4.26%, 'C': 6.38%, 'Q': 5.32%, 'E': 6.38%, 'G': 4.26%, 'H': 1.06%, 'I': 7.45%, 'L': 9.57%, 'K': 2.13%, 'M': 2.13%, 'F': 1.06%, 'P': 6.38%, 'S': 3.19%, 'T': 2.13%, 'W': 2.13%, 'Y': 3.19%, 'V': 5.32%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, H, N

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10245 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	100.957	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	43.718	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.229	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.577	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.791	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.274	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.287, 0.149, 0.372 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.064	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	15470, 15845	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Clostridium difficile (Gram-positive), Staphylococcus aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-HSV, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Cytotoxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Daher KA, Lehrer RI, Ganz T, et al. Isolation and characterization of human defensin cDNA clones. Proc Natl Acad Sci U S A. 1988;85(19):7327-31. Published 1988 Oct. doi:10.1073/pnas.85.19.7327

PMID: 3174637

Citation 2: Wiedemann LM, Francis GE, Lamb RF, et al. Differentiation stage-specific expression of a gene during granulopoiesis. Leukemia. 1989;3(3):227-34. Published 1989 Mar. doi:

PMID: 2918759

Citation 3: Linzmeier R, Michaelson D, Liu L, et al. The structure of neutrophil defensin genes. FEBS Lett. 1993;321(2-3):267-73. Published 1993 Apr 26. doi:10.1016/0014-5793(93)80122-b

PMID: 8477861

Citation 4: Linzmeier R, Michaelson D, Liu L, et al. The structure of neutrophil defensin genes. FEBS Lett. 1993;326(1-3):299-300. Published 1993 Jul 12. doi:10.1016/0014-5793(93)81813-f

PMID: 8325384

Citation 5: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 6: Selsted ME, Harwig SS, Ganz T, et al. Primary structures of three human neutrophil defensins. J Clin Invest. 1985;76(4):1436-9. Published 1985 Oct. doi:10.1172/JCI112121

PMID: 4056036

Citation 7: Selsted ME, Harwig SS, Harwig SS. Determination of the disulfide array in the human defensin HNP-2. A covalently cyclized peptide. J Biol Chem. 1989;264(7):4003-7. Published 1989 Mar 5. doi:

PMID: 2917986

Citation 8: Valore EV, Ganz T, Ganz T. Posttranslational processing of defensins in immature human myeloid cells. Blood. 1992;79(6):1538-44. Published 1992 Mar 15. doi:

PMID: 1339298

Citation 9: Ericksen B, Wu Z, Lu W, et al. Antibacterial activity and specificity of the six human {alpha}-defensins. Antimicrob Agents Chemother. 2005;49(1):269-75. Published 2005 Jan. doi:10.1128/AAC.49.1.269-275.2005

PMID: 15616305

Citation 10: Kim C, Gajendran N, MittrÃ¼cker HW, et al. Human alpha-defensins neutralize anthrax lethal toxin and protect against its fatal consequences. Proc Natl Acad Sci U S A. 2005;102(13):4830-5. Published 2005 Mar 29. doi:10.1073/pnas.0500508102

PMID: 15772169

Citation 11: Hazrati E, Galen B, Lu W, et al. Human alpha- and beta-defensins block multiple steps in herpes simplex virus infection. J Immunol. 2006;177(12):8658-66. Published 2006 Dec 15. doi:10.4049/jimmunol.177.12.8658

PMID: 17142766

Citation 12: Giesemann T, Guttenberg G, Aktories K, et al. Human alpha-defensins inhibit Clostridium difficile toxin B. Gastroenterology. 2008;134(7):2049-58. Published 2008 Jun. doi:10.1053/j.gastro.2008.03.008

PMID: 18435932

Citation 13: Cardot-Martin E, Casalegno JS, Badiou C, et al. Î±-Defensins partially protect human neutrophils against Panton-Valentine leukocidin produced by Staphylococcus aureus. Lett Appl Microbiol. 2015;61(2):158-64. Published 2015 Aug. doi:10.1111/lam.12438

PMID: 25963798

Citation 14: Liu X, Chen Q, Luo Y, et al. Plasma levels of alarmin HNPs 1-3 associate with lung dysfunction after cardiac surgery in children. BMC Pulm Med. 2017;17(1):218. Published 2017 Dec 28. doi:10.1186/s12890-017-0558-4

PMID: 29282039

Citation 15: Hill CP, Yee J, Selsted ME, et al. Crystal structure of defensin HNP-3, an amphiphilic dimer: mechanisms of membrane permeabilization. Science. 1991;251(5000):1481-5. Published 1991 Mar 22. doi:10.1126/science.2006422

PMID: 2006422

Citation 16: Xie C, Prahl A, Ericksen B, et al. Reconstruction of the conserved beta-bulge in mammalian defensins using D-amino acids. J Biol Chem. 2005;280(38):32921-9. Published 2005 Sep 23. doi:10.1074/jbc.M503084200

PMID: 15894545

Citation 17: Zou G, de Leeuw E, Li C, et al. Toward understanding the cationicity of defensins. Arg and Lys versus their noncoded analogs. J Biol Chem. 2007;282(27):19653-65. Published 2007 Jul 6. doi:10.1074/jbc.M611003200

PMID: 17452329

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P59666

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	M21131	GenBank \|\| EMBL
2.	M23281	GenBank \|\| EMBL
3.	L12691	GenBank \|\| EMBL
4.	X13621	GenBank \|\| EMBL
5.	BC027917	GenBank \|\| EMBL

CCDS: CCDS5962.1

RefSeq: NP_005208.1

5.5 Protein-Protein Interaction Databases

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

PANTHER: PTHR11876

PROSITE: PS00269

5.8 Genome Annotation Databases

Ensembl: ENSGT00940000153268

5.9 Phylogenomic Databases

GeneTree: ENSGT00940000153268

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

Download