AMPDB_21973 | WAP; Kazal; immunoglobulin; Kunitz and NTR domain-containing protein 1

PEPTIDE SUMMARY

WAP; Kazal; immunoglobulin; Kunitz and NTR domain-containing protein 1

1 General Description

AMPDB ID: AMPDB_21973

Protein Names: WAP; Kazal; immunoglobulin; Kunitz and NTR domain-containing protein 1

Protein Family: WFIKKN family; Snake waprin family

Gene Name: WFIKKN1

Source Organism: Notechis scutatus (mainland tiger snake)

Protein Length: 551 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MLPSLLLSLLPILAEGASLQPIRTNHLGMCPNQLNPNLWVDAQSTCERECQTDQDCEGFEKCCTNVCGLRSCVAARYADGSLSSLEQVQEATCESFVCTQQGSDCDIWDGQPVCKCKDRCEKEPNFTCASDGLTYYNKCYMDAEACIRGISLAVVPCKYIFTWPNTSPVPVETTTHPTPGASPELPIPPALYNNPFHQLVYVGGTVSFHCDVSGRPRPDITWEKQSDHQENFIMRPDQMYGNMVVTNIGQLVIYNAQPEDAGIYTCTARNSAGLLRADFPLSVVKKEHGRGEPRASGTVKLPPDECLREPDTQDCETYQTRWYFDSKKGSCVTFRYGGCGANQNRFNTYEECQLSCVSSTVNLCTLPMVQGPCKNWEPRWAYNHLMKQCHSFIYGSCEGNENNFDSKESCEDACPFPKTLLCKACRLKSKMVLSLCRSDFAIVGRLMEIIEDQDSGIARFALDDVLKDEKMGLKFFDIKYLEVTLTDMDWNCPCPNMTMEDGPLIIMGEVHDGMAVLDPNSYVRTANDKRVKKIYELLEKKTCELFNRFQD

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 28, 'R': 25, 'N': 29, 'D': 36, 'C': 38, 'Q': 24, 'E': 37, 'G': 33, 'H': 9, 'I': 21, 'L': 45, 'K': 28, 'M': 16, 'F': 20, 'P': 36, 'S': 34, 'T': 33, 'W': 8, 'Y': 19, 'V': 32

Frequencies of Amino Acids

'A': 5.08%, 'R': 4.54%, 'N': 5.26%, 'D': 6.53%, 'C': 6.9%, 'Q': 4.36%, 'E': 6.72%, 'G': 5.99%, 'H': 1.63%, 'I': 3.81%, 'L': 8.17%, 'K': 5.08%, 'M': 2.9%, 'F': 3.63%, 'P': 6.53%, 'S': 6.17%, 'T': 5.99%, 'W': 1.45%, 'Y': 3.45%, 'V': 5.81%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

239

Hydrophilic Amino Acid(s) Count

312

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	61909.4 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	68.639	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	45.077	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.386	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.635	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.756	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-21.482	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.263, 0.24, 0.229 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.085	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	72310, 74685	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

No Target Organism Found

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Protease inhibitor, Metalloenzyme inhibitor, Metalloprotease inhibitor, Serine protease inhibitor

4.5 Other Biological Activity

Enzyme inhibitor, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

No PMID found

5.2 Protein Sequence Databases

UniProt: A0A6J1V757

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A6J1V757

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: XP_026536508.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036645, IPR007110, IPR036179, IPR013783, IPR013098, IPR003599, IPR003598, IPR002350, IPR036058, IPR002223, IPR036880, IPR001134, IPR018933, IPR020901, IPR008993, IPR008197, IPR033638

PANTHER: PTHR45938:SF6

PROSITE: PS00280, PS50279, PS50835, PS51465, PS50189, PS51390

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download