AMPDB_2149 | Medusin-AS

PEPTIDE SUMMARY

Medusin-AS

1 General Description

AMPDB ID: AMPDB_2149

Protein Names: Medusin-AS (MDS-AS)

Protein Family: Frog skin active peptide (FSAP) family; Medusin subfamily

Gene Name: Nil

Source Organism: Agalychnis spurrelli (Gliding leaf frog) (Agalychnis litodryas)

Protein Length: 68 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MAFLKKSLFLVLFLGLVSLSVCEEEKRESEEEKNEQEEDDRDERSEEKRLLGMIPLAISAISALSKLG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 4, 'N': 1, 'D': 3, 'C': 1, 'Q': 1, 'E': 13, 'G': 3, 'H': 0, 'I': 3, 'L': 12, 'K': 6, 'M': 2, 'F': 3, 'P': 1, 'S': 8, 'T': 0, 'W': 0, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 5.88%, 'R': 5.88%, 'N': 1.47%, 'D': 4.41%, 'C': 1.47%, 'Q': 1.47%, 'E': 19.12%, 'G': 4.41%, 'H': 0%, 'I': 4.41%, 'L': 17.65%, 'K': 8.82%, 'M': 2.94%, 'F': 4.41%, 'P': 1.47%, 'S': 11.76%, 'T': 0%, 'W': 0%, 'Y': 0%, 'V': 4.41%

Missing Amino Acid(s)

H, T, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, N, P, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7728.87 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	104.706	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	69.447	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.294	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.473	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.306	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-6.041	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.309, 0.191, 0.456 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.044	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.dendrobatidis

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Anti-cancer, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: ProaÃ±o-BolaÃ±os C, Blasco-ZÃºÃ±iga A, Almeida JR, et al. Unravelling the Skin Secretion Peptides of the Gliding Leaf Frog, Agalychnis spurrelli (Hylidae). Biomolecules. 2019;9(11). Published 2019 Oct 30. doi:10.3390/biom9110667

PMID: 31671555

5.2 Protein Sequence Databases

UniProt: A0A5Q0MU22

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A5Q0MU22

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	MK766840	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download