AMPDB_2147 | Dermaseptin-SP4

PEPTIDE SUMMARY

Dermaseptin-SP4

1 General Description

AMPDB ID: AMPDB_2147

Protein Names: Dermaseptin-SP4 (DRS-SP4)

Protein Family: Frog skin active peptide (FSAP) family; Dermaseptin subfamily

Gene Name: Nil

Source Organism: Agalychnis spurrelli (Gliding leaf frog) (Agalychnis litodryas)

Protein Length: 75 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MAFLKKSLFLVLFLGLVSLSMCEEEKRENEVEEEQEDDEQSELRRSLWSSIKDMAAAAGRAALNAVNGILNPGEQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 4, 'N': 4, 'D': 3, 'C': 1, 'Q': 3, 'E': 12, 'G': 4, 'H': 0, 'I': 2, 'L': 11, 'K': 4, 'M': 3, 'F': 3, 'P': 1, 'S': 7, 'T': 0, 'W': 1, 'Y': 0, 'V': 4

Frequencies of Amino Acids

'A': 10.67%, 'R': 5.33%, 'N': 5.33%, 'D': 4%, 'C': 1.33%, 'Q': 4%, 'E': 16%, 'G': 5.33%, 'H': 0%, 'I': 2.67%, 'L': 14.67%, 'K': 5.33%, 'M': 4%, 'F': 4%, 'P': 1.33%, 'S': 9.33%, 'T': 0%, 'W': 1.33%, 'Y': 0%, 'V': 5.33%

Missing Amino Acid(s)

H, T, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, P, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8386.49 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	93.733	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	73.725	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.289	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.629	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.145	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-7.043	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.28, 0.213, 0.453 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.053	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5500	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, E.coli (Gram-negative), K.pneumoniae (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: ProaÃ±o-BolaÃ±os C, Blasco-ZÃºÃ±iga A, Almeida JR, et al. Unravelling the Skin Secretion Peptides of the Gliding Leaf Frog, Agalychnis spurrelli (Hylidae). Biomolecules. 2019;9(11). Published 2019 Oct 30. doi:10.3390/biom9110667

PMID: 31671555

Citation 2: Cuesta S, Gallegos F, Arias J, et al. Molecular modeling of four Dermaseptin-related peptides of the gliding tree frog Agalychnis spurrelli. J Mol Model. 2019;25(9):260. Published 2019 Aug 17. doi:10.1007/s00894-019-4141-1

PMID: 31422479

5.2 Protein Sequence Databases

UniProt: A0A5P9K6A8

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A5P9K6A8

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	MK532482	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR022731, IPR004275, IPR016322

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download