AMPDB_208 | Lantibiotic lacticin-481

1 General Description

AMPDB ID: AMPDB_208

Protein Names: Lantibiotic lacticin-481 (Lactococcin-DR)

Protein Family: Type A lantibiotic family

Gene Name: lctA lcnDR1 lct

Source Organism: Lactococcus lactis subsp. lactis (Streptococcus lactis)

Protein Length: 51 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKEQNSFNLLQEVTESELDLILGAKGGSGVIHTISHECNMNSWQFVFTCCS

FASTA format

Counts of Amino Acids

'A': 1, 'R': 0, 'N': 4, 'D': 1, 'C': 3, 'Q': 3, 'E': 5, 'G': 4, 'H': 2, 'I': 3, 'L': 5, 'K': 2, 'M': 2, 'F': 3, 'P': 0, 'S': 6, 'T': 3, 'W': 1, 'Y': 0, 'V': 3

Frequencies of Amino Acids

'A': 1.96%, 'R': 0%, 'N': 7.84%, 'D': 1.96%, 'C': 5.88%, 'Q': 5.88%, 'E': 9.8%, 'G': 7.84%, 'H': 3.92%, 'I': 5.88%, 'L': 9.8%, 'K': 3.92%, 'M': 3.92%, 'F': 5.88%, 'P': 0%, 'S': 11.76%, 'T': 5.88%, 'W': 1.96%, 'Y': 0%, 'V': 5.88%

Missing Amino Acid(s)

P, R, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

A, D, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5677.41 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	80.196	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	44.359	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.049	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.468	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.409	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.997	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.294, 0.275, 0.255 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.078	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5500, 5625	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Piard JC, Kuipers OP, Rollema HS, et al. Structure, organization, and expression of the lct gene for lacticin 481, a novel lantibiotic produced by Lactococcus lactis. J Biol Chem. 1993;268(22):16361-8. Published 1993 Aug 5. doi:

PMID: 8344922

Citation 2: Rince A, Dufour A, Le Pogam S, et al. Cloning, expression, and nucleotide sequence of genes involved in production of lactococcin DR, a bacteriocin from lactococcus lactis subsp. lactis. Appl Environ Microbiol. 1994;60(5):1652-7. Published 1994 May. doi:10.1128/aem.60.5.1652-1657.1994

PMID: 8017945

Citation 3: Piard JC, Muriana PM, Desmazeaud MJ, et al. Purification and Partial Characterization of Lacticin 481, a Lanthionine-Containing Bacteriocin Produced by Lactococcus lactis subsp. lactis CNRZ 481. Appl Environ Microbiol. 1992;58(1):279-84. Published 1992 Jan. doi:10.1128/aem.58.1.279-284.1992

PMID: 16348628

Citation 4: van den Hooven HW, Lagerwerf FM, Heerma W, et al. The structure of the lantibiotic lacticin 481 produced by Lactococcus lactis: location of the thioether bridges. FEBS Lett. 1996;391(3):317-22. Published 1996 Aug 12. doi:10.1016/0014-5793(96)00771-5

PMID: 8764998

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P36499

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X71410	GenBank \|\| EMBL
2.	U91581	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR007682

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download