AMPDB_206 | Drosocin
PEPTIDE SUMMARY
Drosocin
1 General Description
AMPDB ID: AMPDB_206
Protein Names: Drosocin
Protein Family: Drosocin family
Gene Name: Dro CG10816
Source Organism: Drosophila melanogaster (Fruit fly)
Protein Length: 64 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MKFTIVFLLLACVFAMGVATPGKPRPYSPRPTSHPRPIRVRREALAIEDHLTQAAIRPPPILPA
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 8, 'R': 7, 'N': 0, 'D': 1, 'C': 1, 'Q': 1, 'E': 2, 'G': 2, 'H': 2, 'I': 5, 'L': 6, 'K': 2, 'M': 2, 'F': 3, 'P': 11, 'S': 2, 'T': 4, 'W': 0, 'Y': 1, 'V': 4
Frequencies of Amino Acids
'A': 12.5%, 'R': 10.94%, 'N': 0%, 'D': 1.56%, 'C': 1.56%, 'Q': 1.56%, 'E': 3.13%, 'G': 3.13%, 'H': 3.13%, 'I': 7.81%, 'L': 9.38%, 'K': 3.13%, 'M': 3.13%, 'F': 4.69%, 'P': 17.19%, 'S': 3.13%, 'T': 6.25%, 'W': 0%, 'Y': 1.56%, 'V': 6.25%
Missing Amino Acid(s)
N, W
Most Occurring Amino Acid(s)
P
Less Occurring Amino Acid(s)
C, D, Q, Y
Hydrophobic Amino Acid(s) Count
41
Hydrophilic Amino Acid(s) Count
23
Basic Amino Acid(s) Count
3
Acidic Amino Acid(s) Count
11
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 7084.52 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 97.656 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 59.313 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.116 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.496 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 11.814 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 6.12 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.297, 0.234, 0.281 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.063 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 1490, 1490 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
Gram Negative Bacteria
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Anti-gram-negative
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Bulet P, Dimarcq JL, Hetru C, et al. A novel inducible antibacterial peptide of Drosophila carries an O-glycosylated substitution. J Biol Chem. 1993;268(20):14893-7. Published 1993 Jul 15. doi:
PMID: 8325867
Citation 2: Charlet M, Lagueux M, Reichhart JM, et al. Cloning of the gene encoding the antibacterial peptide drosocin involved in Drosophila immunity. Expression studies during the immune response. Eur J Biochem. 1996;241(3):699-706. Published 1996 Nov 1. doi:10.1111/j.1432-1033.1996.00699.x
PMID: 8944755
Citation 3: Lazzaro BP, Clark AG, Clark AG. Molecular population genetics of inducible antibacterial peptide genes in Drosophila melanogaster. Mol Biol Evol. 2003;20(6):914-23. Published 2003 Jun. doi:10.1093/molbev/msg109
PMID: 12716986
Citation 4: Adams MD, Celniker SE, Holt RA, et al. The genome sequence of Drosophila melanogaster. Science. 2000;287(5461):2185-95. Published 2000 Mar 24. doi:10.1126/science.287.5461.2185
PMID: 10731132
Citation 5: Misra S, Crosby MA, Mungall CJ, et al. Annotation of the Drosophila melanogaster euchromatic genome: a systematic review. Genome Biol. 2002;3(12):RESEARCH0083. Published 2002. doi:10.1186/gb-2002-3-12-research0083
PMID: 12537572
Citation 6: Stapleton M, Carlson J, Brokstein P, et al. A Drosophila full-length cDNA resource. Genome Biol. 2002;3(12):RESEARCH0080. Published 2002. doi:10.1186/gb-2002-3-12-research0080
PMID: 12537569
Citation 7: Uttenweiler-Joseph S, Moniatte M, Lagueux M, et al. Differential display of peptides induced during the immune response of Drosophila: a matrix-assisted laser desorption ionization time-of-flight mass spectrometry study. Proc Natl Acad Sci U S A. 1998;95(19):11342-7. Published 1998 Sep 15. doi:10.1073/pnas.95.19.11342
PMID: 9736738
Citation 8: McManus AM, Otvos L Jr, Hoffmann R, et al. Conformational studies by NMR of the antimicrobial peptide, drosocin, and its non-glycosylated derivative: effects of glycosylation on solution conformation. Biochemistry. 1999;38(2):705-14. Published 1999 Jan 12. doi:10.1021/bi981956d
PMID: 9888811
5.2 Protein Sequence Databases
UniProt: P36193
5.3 3D Structure Databases
Sl. no. PDB ID Method Resolution Access Links 3D View
AlphaFoldDB: P36193
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. Z21942 GenBank || EMBL
2. X98416 GenBank || EMBL
3. AY224606 GenBank || EMBL
4. AY224607 GenBank || EMBL
5. AY224608 GenBank || EMBL
6. AY224609 GenBank || EMBL
7. AY224610 GenBank || EMBL
8. AY224611 GenBank || EMBL
9. AY224612 GenBank || EMBL
10. AY224613 GenBank || EMBL
11. AY224614 GenBank || EMBL
12. AY224615 GenBank || EMBL
13. AY224616 GenBank || EMBL
14. AY224617 GenBank || EMBL
15. AY224643 GenBank || EMBL
16. AY224644 GenBank || EMBL
17. AY224645 GenBank || EMBL
18. AY224646 GenBank || EMBL
19. AY224647 GenBank || EMBL
20. AY224648 GenBank || EMBL
21. AY224649 GenBank || EMBL
22. AY224650 GenBank || EMBL
23. AY224651 GenBank || EMBL
24. AY224652 GenBank || EMBL
25. AY224653 GenBank || EMBL
26. AY224654 GenBank || EMBL
27. AY224655 GenBank || EMBL
28. AY224656 GenBank || EMBL
29. AY224657 GenBank || EMBL
30. AY224658 GenBank || EMBL
31. AY224659 GenBank || EMBL
32. AY224660 GenBank || EMBL
33. AY224661 GenBank || EMBL
34. AY224662 GenBank || EMBL
35. AE013599 GenBank || EMBL
36. AY113579 GenBank || EMBL
CCDS: Not found
RefSeq: NP_001246324.1, NP_523744.1
5.5 Protein-Protein Interaction Databases
STRING: 7227.FBpp0301076
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: Not found
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: dme:Dmel_CG10816
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India