AMPDB_202 | Puroindoline-A

1 General Description

AMPDB ID: AMPDB_202

Protein Names: Puroindoline-A

Protein Family: Nil

Gene Name: PINA

Source Organism: Triticum aestivum (Wheat)

Protein Length: 148 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKALFLIGLLALVASTAFAQYSEVVGSYDVAGGGGAQQCPVETKLNSCRNYLLDRCSTMKDFPVTWRWWKWWKGGCQELLGECCSRLGQMPPQCRCNIIQGSIQGDLGGIFGFQRDRASKVIQEAKNLPPRCNQGPPCNIPGTIGYYW

FASTA format

Counts of Amino Acids

'A': 9, 'R': 8, 'N': 6, 'D': 5, 'C': 10, 'Q': 11, 'E': 5, 'G': 18, 'H': 0, 'I': 8, 'L': 13, 'K': 7, 'M': 3, 'F': 5, 'P': 9, 'S': 8, 'T': 5, 'W': 6, 'Y': 5, 'V': 7

Frequencies of Amino Acids

'A': 6.08%, 'R': 5.41%, 'N': 4.05%, 'D': 3.38%, 'C': 6.76%, 'Q': 7.43%, 'E': 3.38%, 'G': 12.16%, 'H': 0%, 'I': 5.41%, 'L': 8.78%, 'K': 4.73%, 'M': 2.03%, 'F': 3.38%, 'P': 6.08%, 'S': 5.41%, 'T': 3.38%, 'W': 4.05%, 'Y': 3.38%, 'V': 4.73%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	16386.9 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	75.135	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	40.859	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.172	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.583	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.409	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	4.383	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.297, 0.277, 0.203 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.108	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	40450, 41075	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

A.tumefaciens (Gram-negative), C.michiganensis (Gram-positive), E.coli (Gram-negative), P.syringae (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Plant defense, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Toxin, Synergistic peptide, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Gautier MF, Aleman ME, Guirao A, et al. Triticum aestivum puroindolines, two basic cystine-rich seed proteins: cDNA sequence analysis and developmental gene expression. Plant Mol Biol. 1994;25(1):43-57. Published 1994 Apr. doi:10.1007/BF00024197

PMID: 7516201

Citation 2: Blochet JE, Chevalier C, Forest E, et al. Complete amino acid sequence of puroindoline, a new basic and cystine-rich protein with a unique tryptophan-rich domain, isolated from wheat endosperm by Triton X-114 phase partitioning. FEBS Lett. 1993;329(3):336-40. Published 1993 Aug 30. doi:10.1016/0014-5793(93)80249-t

PMID: 8365477

Citation 3: Charnet P, Molle G, Marion D, et al. Puroindolines form ion channels in biological membranes. Biophys J. 2003;84(4):2416-26. Published 2003 Apr. doi:10.1016/S0006-3495(03)75046-2

PMID: 12668449

Citation 4: Capparelli R, Amoroso MG, Palumbo D, et al. Two plant puroindolines colocalize in wheat seed and in vitro synergistically fight against pathogens. Plant Mol Biol. 2005;58(6):857-867. Published 2005 Aug. doi:10.1007/s11103-005-8270-9

PMID: 16240178

Citation 5: Day L, Bhandari DG, Greenwell P, et al. Characterization of wheat puroindoline proteins. FEBS J. 2006;273(23):5358-73. Published 2006 Dec. doi:10.1111/j.1742-4658.2006.05528.x

PMID: 17076702

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P33432

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X69913	GenBank \|\| EMBL
2.	X69914	GenBank \|\| EMBL
3.	AJ302091	GenBank \|\| EMBL
4.	DQ363911	GenBank \|\| EMBL
5.	DQ363912	GenBank \|\| EMBL
6.	AB177392	GenBank \|\| EMBL
7.	AB181238	GenBank \|\| EMBL
8.	AY599893	GenBank \|\| EMBL
9.	CR626934	GenBank \|\| EMBL
10.	CT009735	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

PANTHER: PTHR33454

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download