AMPDB_201 | Cathelicidin-4

PEPTIDE SUMMARY

Cathelicidin-4

1 General Description

AMPDB ID: AMPDB_201

Protein Names: Cathelicidin-4 (Indolicidin)

Protein Family: Cathelicidin family

Gene Name: CATHL4

Source Organism: Bos taurus (Bovine)

Protein Length: 144 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MQTQRASLSLGRWSLWLLLLGLVVPSASAQALSYREAVLRAVDQLNELSSEANLYRLLELDPPPKDNEDLGTRKPVSFTVKETVCPRTIQQPAEQCDFKEKGRVKQCVGTVTLDPSNDQFDLNCNELQSVILPWKWPWWPWRRG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 8, 'R': 10, 'N': 6, 'D': 8, 'C': 4, 'Q': 10, 'E': 9, 'G': 6, 'H': 0, 'I': 2, 'L': 21, 'K': 7, 'M': 1, 'F': 3, 'P': 11, 'S': 11, 'T': 7, 'W': 7, 'Y': 2, 'V': 11

Frequencies of Amino Acids

'A': 5.56%, 'R': 6.94%, 'N': 4.17%, 'D': 5.56%, 'C': 2.78%, 'Q': 6.94%, 'E': 6.25%, 'G': 4.17%, 'H': 0%, 'I': 1.39%, 'L': 14.58%, 'K': 4.86%, 'M': 0.69%, 'F': 2.08%, 'P': 7.64%, 'S': 7.64%, 'T': 4.86%, 'W': 4.86%, 'Y': 1.39%, 'V': 7.64%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	16478.9 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	90	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	38.393	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.422	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.665	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.536	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.234	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.319, 0.236, 0.271 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.083	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	41480, 41730	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Del Sal G, Storici P, Schneider C, et al. cDNA cloning of the neutrophil bactericidal peptide indolicidin. Biochem Biophys Res Commun. 1992;187(1):467-72. Published 1992 Aug 31. doi:10.1016/s0006-291x(05)81517-7

PMID: 1520337

Citation 2: Selsted ME, Novotny MJ, Morris WL, et al. Indolicidin, a novel bactericidal tridecapeptide amide from neutrophils. J Biol Chem. 1992;267(7):4292-5. Published 1992 Mar 5. doi:

PMID: 1537821

Citation 3: Lee DG, Kim HK, Kim SA, et al. Fungicidal effect of indolicidin and its interaction with phospholipid membranes. Biochem Biophys Res Commun. 2003;305(2):305-10. Published 2003 May 30. doi:10.1016/s0006-291x(03)00755-1

PMID: 12745074

Citation 4: Rozek A, Friedrich CL, Hancock RE, et al. Structure of the bovine antimicrobial peptide indolicidin bound to dodecylphosphocholine and sodium dodecyl sulfate micelles. Biochemistry. 2000;39(51):15765-74. Published 2000 Dec 26. doi:

PMID: 11123901

5.2 Protein Sequence Databases

UniProt: P33046

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P33046

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X67340	GenBank \|\| EMBL
2.	BC133480	GenBank \|\| EMBL

CCDS: Not found

RefSeq: NP_777252.1

5.5 Protein-Protein Interaction Databases

STRING: 9913.ENSBTAP00000026747

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001894, IPR018216, IPR046350

PANTHER: PTHR10206

PROSITE: PS00946, PS00947

5.8 Genome Annotation Databases

Ensembl: ENSGT00390000000410

KEGG: bta:282166

5.9 Phylogenomic Databases

GeneTree: ENSGT00390000000410

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download