AMPDB_185 | Regenerating islet-derived protein 3-beta

1 General Description

AMPDB ID: AMPDB_185

Protein Names: Regenerating islet-derived protein 3-beta (REG-3-beta) (Pancreatitis-associated protein 1) (Peptide 23) (REG-2) (Regenerating islet-derived protein III-beta) (Reg III-beta) [Cleaved into: Regenerating islet-derived protein 3-beta 16.5 kDa form; Regenerating islet-derived protein 3-beta 15 kDa form]

Protein Family: Nil

Gene Name: Reg3b Pap Pap1 Reg2

Source Organism: Rattus norvegicus (Rat)

Protein Length: 175 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MLHRLAFPVMSWMLLSCLMLLSQVQGEDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG

FASTA format

Counts of Amino Acids

'A': 10, 'R': 8, 'N': 9, 'D': 6, 'C': 7, 'Q': 7, 'E': 8, 'G': 15, 'H': 3, 'I': 5, 'L': 18, 'K': 7, 'M': 6, 'F': 7, 'P': 10, 'S': 18, 'T': 8, 'W': 7, 'Y': 7, 'V': 9

Frequencies of Amino Acids

'A': 5.71%, 'R': 4.57%, 'N': 5.14%, 'D': 3.43%, 'C': 4%, 'Q': 4%, 'E': 4.57%, 'G': 8.57%, 'H': 1.71%, 'I': 2.86%, 'L': 10.29%, 'K': 4%, 'M': 3.43%, 'F': 4%, 'P': 5.71%, 'S': 10.29%, 'T': 4.57%, 'W': 4%, 'Y': 4%, 'V': 5.14%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

L, S

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	19617.4 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	71.886	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	42.342	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.229	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.629	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.73	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.846	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.303, 0.297, 0.24 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.12	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	48930, 49305	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

4.2 Antimicrobial Activity

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Lectin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Iovanna J, Orelle B, Keim V, et al. Messenger RNA sequence and expression of rat pancreatitis-associated protein, a lectin-related protein overexpressed during acute experimental pancreatitis. J Biol Chem. 1991;266(36):24664-9. Published 1991 Dec 25. doi:

PMID: 1722211

Citation 2: Iovanna JL, Keim V, Bosshard A, et al. PAP, a pancreatic secretory protein induced during acute pancreatitis, is expressed in rat intestine. Am J Physiol. 1993;265(4 Pt 1):G611-8. Published 1993 Oct. doi:10.1152/ajpgi.1993.265.4.G611

PMID: 8238345

Citation 3: Dusetti NJ, Frigerio JM, Keim V, et al. Structural organization of the gene encoding the rat pancreatitis-associated protein. Analysis of its evolutionary history reveals an ancient divergence from the other carbohydrate-recognition domain-containing genes. J Biol Chem. 1993;268(19):14470-5. Published 1993 Jul 5. doi:

PMID: 8314803

Citation 4: Kamimura T, West C, Beutler E, et al. Sequence of a cDNA clone encoding a rat Reg-2 protein. Gene. 1992;118(2):299-300. Published 1992 Sep 10. doi:10.1016/0378-1119(92)90206-5

PMID: 1511905

Citation 5: Katsumata N, Chakraborty C, Myal Y, et al. Molecular cloning and expression of peptide 23, a growth hormone-releasing hormone-inducible pituitary protein. Endocrinology. 1995;136(4):1332-9. Published 1995 Apr. doi:10.1210/endo.136.4.7895644

PMID: 7895644

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P25031

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	M55149	GenBank \|\| EMBL
2.	M98049	GenBank \|\| EMBL
3.	L07127	GenBank \|\| EMBL
4.	S43715	GenBank \|\| EMBL
5.	S77413	GenBank \|\| EMBL

RefSeq: NP_445741.1

5.5 Protein-Protein Interaction Databases

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

PANTHER: Not found

PROSITE: PS00615, PS50041

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download