AMPDB_182 | Diptericin A

1 General Description

AMPDB ID: AMPDB_182

Protein Names: Diptericin A

Protein Family: Attacin sarcotoxin-2 family

Gene Name: DptA Dipt Dpt CG12763

Source Organism: Drosophila melanogaster (Fruit fly)

Protein Length: 106 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

MQFTIAVALLCCAIASTLAYPMPDDMTMKPTPPPQYPLNLQGGGGGQSGDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRFPNF

FASTA format

Counts of Amino Acids

'A': 6, 'R': 2, 'N': 5, 'D': 4, 'C': 2, 'Q': 7, 'E': 2, 'G': 18, 'H': 3, 'I': 3, 'L': 7, 'K': 3, 'M': 4, 'F': 5, 'P': 10, 'S': 6, 'T': 7, 'W': 2, 'Y': 6, 'V': 4

Frequencies of Amino Acids

'A': 5.66%, 'R': 1.89%, 'N': 4.72%, 'D': 3.77%, 'C': 1.89%, 'Q': 6.6%, 'E': 1.89%, 'G': 16.98%, 'H': 2.83%, 'I': 2.83%, 'L': 6.6%, 'K': 2.83%, 'M': 3.77%, 'F': 4.72%, 'P': 9.43%, 'S': 5.66%, 'T': 6.6%, 'W': 1.89%, 'Y': 5.66%, 'V': 3.77%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, E, R, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	11313.7 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	53.396	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	28.724	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.392	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.41	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.773	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.854	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.255, 0.368, 0.179 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.123	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	19940, 20065	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Gram Negative Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Wicker C, Reichhart JM, Hoffmann D, et al. Insect immunity. Characterization of a Drosophila cDNA encoding a novel member of the diptericin family of immune peptides. J Biol Chem. 1990;265(36):22493-8. Published 1990 Dec 25. doi:

PMID: 2125051

Citation 2: Reichhart JM, Meister M, Dimarcq JL, et al. Insect immunity: developmental and inducible activity of the Drosophila diptericin promoter. EMBO J. 1992;11(4):1469-77. Published 1992 Apr. doi:10.1002/j.1460-2075.1992.tb05191.x

PMID: 1373375

Citation 3: Clark AG, Wang L, Wang L. Molecular population genetics of Drosophila immune system genes. Genetics. 1997;147(2):713-24. Published 1997 Oct. doi:10.1093/genetics/147.2.713

PMID: 9335607

Citation 4: Adams MD, Celniker SE, Holt RA, et al. The genome sequence of Drosophila melanogaster. Science. 2000;287(5461):2185-95. Published 2000 Mar 24. doi:10.1126/science.287.5461.2185

PMID: 10731132

Citation 5: Misra S, Crosby MA, Mungall CJ, et al. Annotation of the Drosophila melanogaster euchromatic genome: a systematic review. Genome Biol. 2002;3(12):RESEARCH0083. Published 2002. doi:10.1186/gb-2002-3-12-research0083

PMID: 12537572

Citation 6: Stapleton M, Carlson J, Brokstein P, et al. A Drosophila full-length cDNA resource. Genome Biol. 2002;3(12):RESEARCH0080. Published 2002. doi:10.1186/gb-2002-3-12-research0080

PMID: 12537569

Citation 7: Leulier F, Rodriguez A, Khush RS, et al. The Drosophila caspase Dredd is required to resist gram-negative bacterial infection. EMBO Rep. 2000;1(4):353-8. Published 2000 Oct. doi:10.1093/embo-reports/kvd073

PMID: 11269502

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: P24492

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	M55432	GenBank \|\| EMBL
2.	Z11728	GenBank \|\| EMBL
3.	AF019020	GenBank \|\| EMBL
4.	AF019021	GenBank \|\| EMBL
5.	AF019022	GenBank \|\| EMBL
6.	AF019023	GenBank \|\| EMBL
7.	AF019024	GenBank \|\| EMBL
8.	AF019025	GenBank \|\| EMBL
9.	AF019026	GenBank \|\| EMBL
10.	AF019027	GenBank \|\| EMBL
11.	AF019028	GenBank \|\| EMBL
12.	AF019029	GenBank \|\| EMBL
13.	AF019030	GenBank \|\| EMBL
14.	AF019031	GenBank \|\| EMBL
15.	AF019032	GenBank \|\| EMBL
16.	AF019033	GenBank \|\| EMBL
17.	AF019034	GenBank \|\| EMBL
18.	AE013599	GenBank \|\| EMBL
19.	AY071667	GenBank \|\| EMBL

RefSeq: NP_476808.1

5.5 Protein-Protein Interaction Databases

STRING: 7227.FBpp0085802

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: ENSGT00940000176590

5.9 Phylogenomic Databases

GeneTree: ENSGT00940000176590

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download