AMPDB_181 | Granulysin

1 General Description

AMPDB ID: AMPDB_181

Protein Names: Granulysin (Lymphokine LAG-2) (Protein NKG5) (T-cell activation protein 519)

Protein Family: Nil

Gene Name: GNLY LAG2 NKG5 TLA519

Source Organism: Homo sapiens (Human)

Protein Length: 145 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL

FASTA format

Counts of Amino Acids

'A': 11, 'R': 16, 'N': 3, 'D': 7, 'C': 7, 'Q': 9, 'E': 7, 'G': 9, 'H': 1, 'I': 3, 'L': 20, 'K': 6, 'M': 4, 'F': 2, 'P': 7, 'S': 8, 'T': 11, 'W': 2, 'Y': 4, 'V': 8

Frequencies of Amino Acids

'A': 7.59%, 'R': 11.03%, 'N': 2.07%, 'D': 4.83%, 'C': 4.83%, 'Q': 6.21%, 'E': 4.83%, 'G': 6.21%, 'H': 0.69%, 'I': 2.07%, 'L': 13.79%, 'K': 4.14%, 'M': 2.76%, 'F': 1.38%, 'P': 4.83%, 'S': 5.52%, 'T': 7.59%, 'W': 1.38%, 'Y': 2.76%, 'V': 5.52%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	16374 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	85.448	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	45.539	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.358	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.86	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.404	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.665	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.269, 0.186, 0.29 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.055	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	16960, 17335	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Mycobacterium (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-parasitic, Anti-tuberculosis, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Jongstra J, Schall TJ, Dyer BJ, et al. The isolation and sequence of a novel gene from a human functional T cell line. J Exp Med. 1987;165(3):601-14. Published 1987 Mar 1. doi:10.1084/jem.165.3.601

PMID: 2434598

Citation 2: Yabe T, McSherry C, Bach FH, et al. A cDNA clone expressed in natural killer and T cells that likely encodes a secreted protein. J Exp Med. 1990;172(4):1159-63. Published 1990 Oct 1. doi:10.1084/jem.172.4.1159

PMID: 2212946

Citation 3: Houchins JP, Kricek F, Chujor CS, et al. Genomic structure of NKG5, a human NK and T cell-specific activation gene. Immunogenetics. 1993;37(2):102-7. Published 1993. doi:10.1007/BF00216832

PMID: 8423048

Citation 4: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 5: Krensky AM, Krensky AM. Granulysin: a novel antimicrobial peptide of cytolytic T lymphocytes and natural killer cells. Biochem Pharmacol. 2000;59(4):317-20. Published 2000 Feb 15. doi:10.1016/s0006-2952(99)00177-x

PMID: 10644038

Citation 6: Stenger S, Hanson DA, Teitelbaum R, et al. An antimicrobial activity of cytolytic T cells mediated by granulysin. Science. 1998;282(5386):121-5. Published 1998 Oct 2. doi:10.1126/science.282.5386.121

PMID: 9756476

Citation 7: Hanson DA, Kaspar AA, Poulain FR, et al. Biosynthesis of granulysin, a novel cytolytic molecule. Mol Immunol. 1999;36(7):413-22. Published 1999 May. doi:10.1016/s0161-5890(99)00063-2

PMID: 10449094

Citation 8: Anderson DH, Sawaya MR, Cascio D, et al. Granulysin crystal structure and a structure-derived lytic mechanism. J Mol Biol. 2003;325(2):355-65. Published 2003 Jan 10. doi:10.1016/s0022-2836(02)01234-2

PMID: 12488100

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P22749

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X05044	GenBank \|\| EMBL
2.	X54101	GenBank \|\| EMBL
3.	M85276	GenBank \|\| EMBL
4.	CR541859	GenBank \|\| EMBL
5.	BC023576	GenBank \|\| EMBL

5.5 Protein-Protein Interaction Databases

5.6 Ligand Databases

BindingDB: Not found

DrugBank: DB03434

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR038847, IPR011001, IPR008139

PANTHER: PTHR15541

PROSITE: PS50015

5.8 Genome Annotation Databases

Ensembl: ENSGT00390000002975

5.9 Phylogenomic Databases

GeneTree: ENSGT00390000002975

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

Download