AMPDB_180 | Cathelicidin-1

PEPTIDE SUMMARY

Cathelicidin-1

1 General Description

AMPDB ID: AMPDB_180

Protein Names: Cathelicidin-1 (Bactenecin-1) (Bac1) (Cyclic dodecapeptide)

Protein Family: Cathelicidin family

Gene Name: CATHL1 BAC1

Source Organism: Bos taurus (Bovine)

Protein Length: 155 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

METPRASLSLGRWSLWLLLLGLALPSASAQALSYREAVLRAVDQLNEQSSEPNIYRLLELDQPPQDDEDPDSPKRVSFRVKETVCSRTTQQPPEQCDFKENGLLKRCEGTVTLDQVRGNFDITCNNHQSIRITKQPWAPPQAARLCRIVVIRVCR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 10, 'R': 15, 'N': 6, 'D': 9, 'C': 6, 'Q': 12, 'E': 10, 'G': 5, 'H': 1, 'I': 6, 'L': 19, 'K': 5, 'M': 1, 'F': 3, 'P': 12, 'S': 12, 'T': 8, 'W': 3, 'Y': 2, 'V': 10

Frequencies of Amino Acids

'A': 6.45%, 'R': 9.68%, 'N': 3.87%, 'D': 5.81%, 'C': 3.87%, 'Q': 7.74%, 'E': 6.45%, 'G': 3.23%, 'H': 0.65%, 'I': 3.87%, 'L': 12.26%, 'K': 3.23%, 'M': 0.65%, 'F': 1.94%, 'P': 7.74%, 'S': 7.74%, 'T': 5.16%, 'W': 1.94%, 'Y': 1.29%, 'V': 6.45%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	17600.1 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	88.065	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	49.918	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.496	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.658	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.756	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.736	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.277, 0.226, 0.258 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.052	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	19480, 19855	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Storici P, Del Sal G, Schneider C, et al. cDNA sequence analysis of an antibiotic dodecapeptide from neutrophils. FEBS Lett. 1992;314(2):187-90. Published 1992 Dec 14. doi:10.1016/0014-5793(92)80971-i

PMID: 1459251

Citation 2: Romeo D, Skerlavaj B, Bolognesi M, et al. Structure and bactericidal activity of an antibiotic dodecapeptide purified from bovine neutrophils. J Biol Chem. 1988;263(20):9573-5. Published 1988 Jul 15. doi:

PMID: 3290210

Citation 3: Storici P, Tossi A, Lenarcic B, et al. Purification and structural characterization of bovine cathelicidins, precursors of antimicrobial peptides. Eur J Biochem. 1996;238(3):769-76. Published 1996 Jun 15. doi:10.1111/j.1432-1033.1996.0769w.x

PMID: 8706679

5.2 Protein Sequence Databases

UniProt: P22226

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P22226

5.4 Nucleotide Sequence Databases