AMPDB_170 | Lysozyme C-1

PEPTIDE SUMMARY

Lysozyme C-1

1 General Description

AMPDB ID: AMPDB_170

Protein Names: Lysozyme C-1 (EC 3.2.1.17) (1;4-beta-N-acetylmuramidase C) (Lysozyme C type P)

Protein Family: Glycosyl hydrolase 22 family

Gene Name: Lyz1 Lzp-s

Source Organism: Mus musculus (Mouse)

Protein Length: 148 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRATNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRDPQGIRAWVAWRTQCQNRDLSQYIRNCGV

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 14, 'R': 15, 'N': 12, 'D': 9, 'C': 8, 'Q': 9, 'E': 2, 'G': 10, 'H': 1, 'I': 8, 'L': 14, 'K': 7, 'M': 2, 'F': 1, 'P': 2, 'S': 7, 'T': 8, 'W': 4, 'Y': 7, 'V': 8

Frequencies of Amino Acids

'A': 9.46%, 'R': 10.14%, 'N': 8.11%, 'D': 6.08%, 'C': 5.41%, 'Q': 6.08%, 'E': 1.35%, 'G': 6.76%, 'H': 0.68%, 'I': 5.41%, 'L': 9.46%, 'K': 4.73%, 'M': 1.35%, 'F': 0.68%, 'P': 1.35%, 'S': 4.73%, 'T': 5.41%, 'W': 2.7%, 'Y': 4.73%, 'V': 5.41%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, H

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	16794.2 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	83.108	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	18.003	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.449	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.823	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.703	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	10.593	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.284, 0.209, 0.216 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.081	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	32430, 32930	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antimicrobial, Bacteriolytic enzyme, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Glycosidase, Hydrolase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Cortopassi GA, Wilson AC, Wilson AC. Recent origin of the P lysozyme gene in mice. Nucleic Acids Res. 1990;18(7):1911. Published 1990 Apr 11. doi:10.1093/nar/18.7.1911

PMID: 2336377

Citation 2: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 3: Cross M, Renkawitz R, Renkawitz R. Repetitive sequence involvement in the duplication and divergence of mouse lysozyme genes. EMBO J. 1990;9(4):1283-8. Published 1990 Apr. doi:10.1002/j.1460-2075.1990.tb08237.x

PMID: 2323338

Citation 4: Markart P, Faust N, Graf T, et al. Comparison of the microbicidal and muramidase activities of mouse lysozyme M and P. Biochem J. 2004;380(Pt 2):385-92. Published 2004 Jun 1. doi:10.1042/BJ20031810

PMID: 14977423

5.2 Protein Sequence Databases

UniProt: P17897

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P17897

5.4 Nucleotide Sequence Databases