AMPDB_16588 | Uncharacterized protein

PEPTIDE SUMMARY

Uncharacterized protein

1 General Description

AMPDB ID: AMPDB_16588

Protein Names: Uncharacterized protein

Protein Family: Nil

Gene Name: Nil

Source Organism: Klebsiella pneumoniae

Protein Length: 466 AA

Protein Existence: Predicted

2 Protein Sequence & Composition

2.1 Sequence

MAFGLPALATPGAEGLALSVSGDALSAAVADVLAALKGPFKFGLWGIAIYGVLPSEIAKDDPKMMSKIMTSLPADAVTETPASTLPLDQATVRVRQRVVDVVKDERQHIAVVAGRPMSVPVVDAKPTKRPGVFSVSIPGLPSLQVNVPKGVPTAKAPPKGIVAEKGDSRPAGFTAGGNSREAVIRFPKETGQKPVYVSVTDVLTPAQVKQRQEEEKRRQQAWDAAHPEEGLKRDYDKAKAELDAEDKNIATLNSRIASTEKALPGARAAVQEADKKVKEAEANKDDFVTYNPPHEYGSGWQDQVRYLDKDIQNQNEKLKAAQASLNAMNESLSRDKAALTGAMESRKQKEKKAKDAENKLNEEKNKPRKGVKDYGHDYHPAPKTEEIKGLGELKKAPKKTPKQGGGGRRDRWIGDKGRKIYEWDSQHGELEGYRASDGEHLGAFDPKTGKQIKGPDPKGRNIKKYL

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 55, 'R': 25, 'N': 14, 'D': 32, 'C': 0, 'Q': 20, 'E': 33, 'G': 40, 'H': 7, 'I': 16, 'L': 30, 'K': 54, 'M': 7, 'F': 8, 'P': 34, 'S': 23, 'T': 19, 'W': 5, 'Y': 11, 'V': 33

Frequencies of Amino Acids

'A': 11.8%, 'R': 5.36%, 'N': 3%, 'D': 6.87%, 'C': 0%, 'Q': 4.29%, 'E': 7.08%, 'G': 8.58%, 'H': 1.5%, 'I': 3.43%, 'L': 6.44%, 'K': 11.59%, 'M': 1.5%, 'F': 1.72%, 'P': 7.3%, 'S': 4.94%, 'T': 4.08%, 'W': 1.07%, 'Y': 2.36%, 'V': 7.08%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

228

Hydrophilic Amino Acid(s) Count

238

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	50623.4 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	70.837	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	40.125	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.759	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.73	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.033	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	14.682	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.221, 0.238, 0.268 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.052	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	43890, 43890	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative

4.3 Enzymatic Activity

Endonuclease, Hydrolase, Nuclease

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

No PMID found

5.2 Protein Sequence Databases

UniProt: A0A482M233

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A482M233

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	MH909332	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR024575, IPR036725, IPR009105, IPR024566, IPR016128, IPR036302

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download