AMPDB_144 | Pteroicidin-alpha
PEPTIDE SUMMARY
Pteroicidin-alpha
1 General Description
AMPDB ID: AMPDB_144
Protein Names: Pteroicidin-alpha (Alpha-Pte-CONH2) (Alpha-Pte-COOH) (Piscidin-like peptide)
Protein Family: Pleurocidin family
Gene Name: Nil
Protein Length: 66 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MKCIALFLVLSMVVLMAEPGEAFIHHIIGGLFHVGKSIHDLIRGKNRDMAEQQELERAFDRERAFA
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 7, 'R': 5, 'N': 1, 'D': 3, 'C': 1, 'Q': 2, 'E': 6, 'G': 5, 'H': 4, 'I': 6, 'L': 7, 'K': 3, 'M': 4, 'F': 5, 'P': 1, 'S': 2, 'T': 0, 'W': 0, 'Y': 0, 'V': 4
Frequencies of Amino Acids
'A': 10.61%, 'R': 7.58%, 'N': 1.52%, 'D': 4.55%, 'C': 1.52%, 'Q': 3.03%, 'E': 9.09%, 'G': 7.58%, 'H': 6.06%, 'I': 9.09%, 'L': 10.61%, 'K': 4.55%, 'M': 6.06%, 'F': 7.58%, 'P': 1.52%, 'S': 3.03%, 'T': 0%, 'W': 0%, 'Y': 0%, 'V': 6.06%
Missing Amino Acid(s)
T, W, Y
Most Occurring Amino Acid(s)
A, L
Less Occurring Amino Acid(s)
C, N, P
Hydrophobic Amino Acid(s) Count
39
Hydrophilic Amino Acid(s) Count
27
Basic Amino Acid(s) Count
9
Acidic Amino Acid(s) Count
12
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 7507.84 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 105 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 31.967 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) 0.195 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.808 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 6.955 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) -0.689 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.333, 0.136, 0.364 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.076 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 0, 0 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
A.salmonicida (Gram-negative), E.coli (Gram-negative), S.aureus (Gram-positive), V.vulnificus (Gram-negative)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Houyvet B, Bouchon-Navaro Y, Bouchon C, et al. Identification of a moronecidin-like antimicrobial peptide in the venomous fish Pterois volitans: Functional and structural study of pteroicidin-α. Fish Shellfish Immunol. 2018;72:318-324. Published 2018 Jan. doi:10.1016/j.fsi.2017.11.003
PMID: 29108968
5.2 Protein Sequence Databases
UniProt: P0DUJ5
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: P0DUJ5
5.4 Nucleotide Sequence Databases
No entries found in GenBank or EMBL
CCDS: Not found
RefSeq: Not found
5.5 Protein-Protein Interaction Databases
STRING: Not found
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
InterPro: IPR012515
PANTHER: Not found
PROSITE: Not found
5.8 Genome Annotation Databases
Ensembl: Not found
KEGG: Not found
5.9 Phylogenomic Databases
GeneTree: Not found
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India