AMPDB_142 | Non-toxic phospholiapse A2

PEPTIDE SUMMARY

Non-toxic phospholiapse A2

1 General Description

AMPDB ID: AMPDB_142

Protein Names: Non-toxic phospholiapse A2 (WaPLA2) (svPLA2) (Phosphatidylcholine 2-acylhydrolase) (EC 3.1.1.4)

Protein Family: Phospholipase A2 family; Group I subfamily

Gene Name: Nil

Source Organism: Walterinnesia aegyptia (Desert black snake)

Protein Length: 30 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

NLYQFKNMVQCVGTQLCVAYVKYGCYCGPG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 1, 'R': 0, 'N': 2, 'D': 0, 'C': 4, 'Q': 3, 'E': 0, 'G': 4, 'H': 0, 'I': 0, 'L': 2, 'K': 2, 'M': 1, 'F': 1, 'P': 1, 'S': 0, 'T': 1, 'W': 0, 'Y': 4, 'V': 4

Frequencies of Amino Acids

'A': 3.33%, 'R': 0%, 'N': 6.67%, 'D': 0%, 'C': 13.33%, 'Q': 10%, 'E': 0%, 'G': 13.33%, 'H': 0%, 'I': 0%, 'L': 6.67%, 'K': 6.67%, 'M': 3.33%, 'F': 3.33%, 'P': 3.33%, 'S': 0%, 'T': 3.33%, 'W': 0%, 'Y': 13.33%, 'V': 13.33%

Missing Amino Acid(s)

D, E, H, I, R, S, W

Most Occurring Amino Acid(s)

C, G, V, Y

Less Occurring Amino Acid(s)

A, F, M, P, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	3350.95 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	68	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	-17.36	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.217	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.482	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.317	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.746	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.367, 0.233, 0.133 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.167	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5960, 6210	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.niger, B.cinerea, F.solani (Gram-positive), P.digitatum

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-Positive

4.3 Enzymatic Activity

Hydrolase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Cytotoxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Ben Bacha A, Alonazi MA, Elshikh MS, et al. A novel bactericidal homodimeric PLA(2) group-I from Walterinnesia aegyptia venom. Int J Biol Macromol. 2018;117:1140-1146. Published 2018 Oct 1. doi:10.1016/j.ijbiomac.2018.06.024

PMID: 29885399

5.2 Protein Sequence Databases

UniProt: P0DQD1

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0DQD1

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001211, IPR036444

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download