AMPDB_140 | L-amino-acid oxidase

PEPTIDE SUMMARY

L-amino-acid oxidase

1 General Description

AMPDB ID: AMPDB_140

Protein Names: L-amino-acid oxidase (LAAO) (LAO) (EC 1.4.3.2)

Protein Family: Flavin monoamine oxidase family; FIG1 subfamily

Gene Name: Nil

Source Organism: Naja oxiana (Central Asian cobra) (Oxus cobra)

Protein Length: 95 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

DDRRSPLEECFQQNDYEEFLEIARNSQLYQESLREDSSYHLSFIESLKSDALFSYEKKFWEADGIHGGKVINDLSLIHDLPKREIQALCYPSIKK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 5, 'N': 3, 'D': 8, 'C': 2, 'Q': 5, 'E': 11, 'G': 3, 'H': 3, 'I': 7, 'L': 11, 'K': 7, 'M': 0, 'F': 5, 'P': 3, 'S': 11, 'T': 0, 'W': 1, 'Y': 5, 'V': 1

Frequencies of Amino Acids

'A': 4.21%, 'R': 5.26%, 'N': 3.16%, 'D': 8.42%, 'C': 2.11%, 'Q': 5.26%, 'E': 11.58%, 'G': 3.16%, 'H': 3.16%, 'I': 7.37%, 'L': 11.58%, 'K': 7.37%, 'M': 0%, 'F': 5.26%, 'P': 3.16%, 'S': 11.58%, 'T': 0%, 'W': 1.05%, 'Y': 5.26%, 'V': 1.05%

Missing Amino Acid(s)

M, T

Most Occurring Amino Acid(s)

E, L, S

Less Occurring Amino Acid(s)

V, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	11216.5 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	81.158	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	70.035	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.762	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.544	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.604	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-6.836	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.316, 0.211, 0.274 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.116	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	12950, 13075	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-parasitic, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Oxidoreductase

4.4 Inhibitory Effect

Platelet aggregation inhibiting toxin

4.5 Other Biological Activity

Cytolysis, Toxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Samel M, TÃµnismÃ¤gi K, RÃ¶nnholm G, et al. L-Amino acid oxidase from Naja naja oxiana venom. Comp Biochem Physiol B Biochem Mol Biol. 2008;149(4):572-80. Published 2008 Apr. doi:10.1016/j.cbpb.2007.11.008

PMID: 18294891

5.2 Protein Sequence Databases

UniProt: P0DI91

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0DI91

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download