AMPDB_14 | Figainin 2

PEPTIDE SUMMARY

Figainin 2

1 General Description

AMPDB ID: AMPDB_14

Protein Names: Figainin 2 (Br22)

Protein Family: Frog skin active peptide (FSAP) family

Gene Name: Nil

Source Organism: Boana raniceps (Chaco tree frog) (Hyla roeschmanni)

Protein Length: 84 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MAFLKKSLFLVLFLGIVSLSVCEEEKREGEEKEEKREEEEGKEENEDGNEEHKEKRFLGAILKIGHALAKTVLPMVTNAFKPKQ

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 3, 'N': 3, 'D': 1, 'C': 1, 'Q': 1, 'E': 18, 'G': 6, 'H': 2, 'I': 3, 'L': 10, 'K': 12, 'M': 2, 'F': 5, 'P': 2, 'S': 3, 'T': 2, 'W': 0, 'Y': 0, 'V': 5

Frequencies of Amino Acids

'A': 5.95%, 'R': 3.57%, 'N': 3.57%, 'D': 1.19%, 'C': 1.19%, 'Q': 1.19%, 'E': 21.43%, 'G': 7.14%, 'H': 2.38%, 'I': 3.57%, 'L': 11.9%, 'K': 14.29%, 'M': 2.38%, 'F': 5.95%, 'P': 2.38%, 'S': 3.57%, 'T': 2.38%, 'W': 0%, 'Y': 0%, 'V': 5.95%

Missing Amino Acid(s)

W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, D, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9632.08 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	83.571	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	54.173	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.652	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.661	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.014	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.853	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.274, 0.167, 0.417 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.06	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Dengue, E.casseliflavus (Gram-positive), E.coli (Gram-negative), E.faecalis (Gram-positive), K.pneumoniae (Gram-negative), P.aeruginosa (Gram-negative), S.aureus (Gram-positive), S.epidermidis (Gram-positive), T.cruzi, Yellow Fever

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Antiviral protein, Anti-candida, Anti-protozoal, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Anti-cancer, Cytolytic, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Santana CJC, MagalhÃ£es ACM, PrÃas-MÃ¡rquez CA, et al. Biological Properties of a Novel Multifunctional Host Defense Peptide from the Skin Secretion of the Chaco Tree Frog, Boana raniceps. Biomolecules. 2020;10(5). Published 2020 May 20. doi:10.3390/biom10050790

PMID: 32443921

5.2 Protein Sequence Databases

UniProt: A0A2L2DDD0

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A2L2DDD0

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	KY748199	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download