AMPDB_137 | L-amino-acid oxidase

PEPTIDE SUMMARY

L-amino-acid oxidase

1 General Description

AMPDB ID: AMPDB_137

Protein Names: L-amino-acid oxidase (BjarLAAO-I) (LAO) (EC 1.4.3.2)

Protein Family: Flavin monoamine oxidase family; FIG1 subfamily

Gene Name: Nil

Source Organism: Bothrops jararaca (Jararaca) (Bothrops jajaraca)

Protein Length: 37 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

ADDKNPLEECFRETDYEEFLEIARNGLKATSNPKRVV

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 3, 'N': 3, 'D': 3, 'C': 1, 'Q': 0, 'E': 6, 'G': 1, 'H': 0, 'I': 1, 'L': 3, 'K': 3, 'M': 0, 'F': 2, 'P': 2, 'S': 1, 'T': 2, 'W': 0, 'Y': 1, 'V': 2

Frequencies of Amino Acids

'A': 8.11%, 'R': 8.11%, 'N': 8.11%, 'D': 8.11%, 'C': 2.7%, 'Q': 0%, 'E': 16.22%, 'G': 2.7%, 'H': 0%, 'I': 2.7%, 'L': 8.11%, 'K': 8.11%, 'M': 0%, 'F': 5.41%, 'P': 5.41%, 'S': 2.7%, 'T': 5.41%, 'W': 0%, 'Y': 2.7%, 'V': 5.41%

Missing Amino Acid(s)

H, M, Q, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, G, I, S, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	4298.75 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	65.946	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	42.038	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.986	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.686	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.37	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.054	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.243, 0.189, 0.324 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.081	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1490	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-parasitic, Anti-gram-Positive

4.3 Enzymatic Activity

Oxidoreductase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Toxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: de Vieira Santos MM, Sant'Ana CD, Giglio JR, et al. Antitumoural effect of an L-amino acid oxidase isolated from Bothrops jararaca snake venom. Basic Clin Pharmacol Toxicol. 2008;102(6):533-42. Published 2008 Jun. doi:10.1111/j.1742-7843.2008.00229.x

PMID: 18346051

Citation 2: Ciscotto P, Machado de Avila RA, Coelho EA, et al. Antigenic, microbicidal and antiparasitic properties of an l-amino acid oxidase isolated from Bothrops jararaca snake venom. Toxicon. 2009;53(3):330-41. Published 2009 Mar 1. doi:10.1016/j.toxicon.2008.12.004

PMID: 19101583

Citation 3: Deolindo P, Teixeira-Ferreira AS, DaMatta RA, et al. L-amino acid oxidase activity present in fractions of Bothrops jararaca venom is responsible for the induction of programmed cell death in Trypanosoma cruzi. Toxicon. 2010;56(6):944-55. Published 2010 Nov. doi:10.1016/j.toxicon.2010.06.019

PMID: 20615423

5.2 Protein Sequence Databases

UniProt: P0DI88

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0DI88

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download