AMPDB_136 | L-amino-acid oxidase

PEPTIDE SUMMARY

L-amino-acid oxidase

1 General Description

AMPDB ID: AMPDB_136

Protein Names: L-amino-acid oxidase (BatroxLAAO) (LAO) (EC 1.4.3.2)

Protein Family: Flavin monoamine oxidase family; FIG1 subfamily

Gene Name: Nil

Source Organism: Bothrops atrox (Barba amarilla) (Fer-de-lance)

Protein Length: 506 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNVFFTFSLLFLAALGSCADDRNPLEECFRETDYEEFLEIAKNGLSTTSNPKRVVIVGAGMSGLSAAYVLANAGHQVTVLEASERAGGRVKTYRNEKEGWYANLGPMRLPEKHRIVREYIRKFDLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLEYPVKPSEVGKSAGQLYEESLQKAVEELRRTNCSYMLNKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDKLPTSMYQAIQEKVHLNARVIKIQQDVKEVTVTYQTSEKETLSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSTTDLPSRFIYYPNHNFPNGVGVIIAYGIGDDANYFQALDFEDCGDIVINDLSLIHQLPKEEIQAICRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNRASEIKK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 37, 'R': 28, 'N': 23, 'D': 28, 'C': 7, 'Q': 17, 'E': 40, 'G': 34, 'H': 11, 'I': 32, 'L': 39, 'K': 34, 'M': 9, 'F': 23, 'P': 20, 'S': 32, 'T': 28, 'W': 5, 'Y': 27, 'V': 32

Frequencies of Amino Acids

'A': 7.31%, 'R': 5.53%, 'N': 4.55%, 'D': 5.53%, 'C': 1.38%, 'Q': 3.36%, 'E': 7.91%, 'G': 6.72%, 'H': 2.17%, 'I': 6.32%, 'L': 7.71%, 'K': 6.72%, 'M': 1.78%, 'F': 4.55%, 'P': 3.95%, 'S': 6.32%, 'T': 5.53%, 'W': 0.99%, 'Y': 5.34%, 'V': 6.32%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

231

Hydrophilic Amino Acid(s) Count

275

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	57408.1 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	80.376	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	40.707	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.415	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.97	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	6.45	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-5.385	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.312, 0.215, 0.247 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.109	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	67730, 68105	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-parasitic, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Oxidoreductase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Toxin, Anti-cancer, Cytotoxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Alves RM, Antonucci GA, Paiva HH, et al. Evidence of caspase-mediated apoptosis induced by l-amino acid oxidase isolated from Bothrops atrox snake venom. Comp Biochem Physiol A Mol Integr Physiol. 2008;151(4):542-50. Published 2008 Dec. doi:10.1016/j.cbpa.2008.07.007

PMID: 18804547

Citation 2: de Melo Alves Paiva R, de Freitas Figueiredo R, Antonucci GA, et al. Cell cycle arrest evidence, parasiticidal and bactericidal properties induced by L-amino acid oxidase from Bothrops atrox snake venom. Biochimie. 2011;93(5):941-7. Published 2011 May. doi:10.1016/j.biochi.2011.01.009

PMID: 21300133

Citation 3: Alves RM, Feliciano PR, Sampaio SV, et al. A rational protocol for the successful crystallization of L-amino-acid oxidase from Bothrops atrox. Acta Crystallogr Sect F Struct Biol Cryst Commun. 2011;67(Pt 4):475-8. Published 2011 Apr 1. doi:10.1107/S1744309111003770

PMID: 21505245

Citation 4: Feliciano PR, Rustiguel JK, Soares RO, et al. Crystal structure and molecular dynamics studies of L-amino acid oxidase from Bothrops atrox. Toxicon. 2017;128:50-59. Published 2017 Mar 15. doi:10.1016/j.toxicon.2017.01.017

PMID: 28137621

5.2 Protein Sequence Databases

UniProt: P0CC17

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: P0CC17

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	GEDR01000075	GenBank \|\| EMBL
2.	KT150252	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR002937, IPR036188, IPR001613

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: 1.4.3.2

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download