AMPDB_1347 | Antimicrobial peptide ToAp1

PEPTIDE SUMMARY

Antimicrobial peptide ToAp1

1 General Description

AMPDB ID: AMPDB_1347

Protein Names: Antimicrobial peptide ToAp1

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Tityus obscurus (Amazonian scorpion) (Tityus cambridgei)

Protein Length: 74 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MQMKYLIPIFFLVLIVADHCHAFIGMIPGLIGGLISAFKGRRKRDITAQIEQYRNIQKREAAELEELLANLPVY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 5, 'N': 2, 'D': 2, 'C': 1, 'Q': 4, 'E': 5, 'G': 5, 'H': 2, 'I': 10, 'L': 9, 'K': 4, 'M': 3, 'F': 4, 'P': 3, 'S': 1, 'T': 1, 'W': 0, 'Y': 3, 'V': 3

Frequencies of Amino Acids

'A': 9.46%, 'R': 6.76%, 'N': 2.7%, 'D': 2.7%, 'C': 1.35%, 'Q': 5.41%, 'E': 6.76%, 'G': 6.76%, 'H': 2.7%, 'I': 13.51%, 'L': 12.16%, 'K': 5.41%, 'M': 4.05%, 'F': 5.41%, 'P': 4.05%, 'S': 1.35%, 'T': 1.35%, 'W': 0%, 'Y': 4.05%, 'V': 4.05%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, S, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8487.14 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	121.351	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	46.653	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.292	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.494	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.159	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.124	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.392, 0.149, 0.324 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.095	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	4470, 4470	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, Candida spp., Cryptococcus neoformans, Mycobacterium abscessus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-biofilm, Anti-candida, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Anti-inflammatory, Cytotoxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: de Oliveira UC, Nishiyama MY Jr, Dos Santos MBV, et al. Proteomic endorsed transcriptomic profiles of venom glands from Tityus obscurus and T. serrulatus scorpions. PLoS One. 2018;13(3):e0193739. Published 2018. doi:10.1371/journal.pone.0193739

PMID: 29561852

Citation 2: Guilhelmelli F, Vilela N, Smidt KS, et al. Activity of Scorpion Venom-Derived Antifungal Peptides against Planktonic Cells of Candida spp. and Cryptococcus neoformans and Candida albicans Biofilms. Front Microbiol. 2016;7:1844. Published 2016. doi:10.3389/fmicb.2016.01844

PMID: 27917162

5.2 Protein Sequence Databases

UniProt: A0A1D3IXR7

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A1D3IXR7

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	GEMQ01000084	GenBank \|\| EMBL
2.	GEMQ01000031	GenBank \|\| EMBL
3.	GEMQ01000022	GenBank \|\| EMBL
4.	LT576029	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download