AMPDB_1346 | Antimicrobial peptide ToAP2

PEPTIDE SUMMARY

Antimicrobial peptide ToAP2

1 General Description

AMPDB ID: AMPDB_1346

Protein Names: Antimicrobial peptide ToAP2

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Medium-length antimicrobial peptide (group 3) family

Gene Name: Nil

Source Organism: Tityus obscurus (Amazonian scorpion) (Tityus cambridgei)

Protein Length: 79 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MQFKKQLLVIFFAYFLVVNESEAFFGTLFKLGSKLIPGVMKLFSKKKERSLMKRELKNLYDPYQRSVEMERLLKELPLY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 4, 'N': 2, 'D': 1, 'C': 0, 'Q': 3, 'E': 7, 'G': 3, 'H': 0, 'I': 2, 'L': 14, 'K': 11, 'M': 4, 'F': 8, 'P': 3, 'S': 5, 'T': 1, 'W': 0, 'Y': 4, 'V': 5

Frequencies of Amino Acids

'A': 2.53%, 'R': 5.06%, 'N': 2.53%, 'D': 1.27%, 'C': 0%, 'Q': 3.8%, 'E': 8.86%, 'G': 3.8%, 'H': 0%, 'I': 2.53%, 'L': 17.72%, 'K': 13.92%, 'M': 5.06%, 'F': 10.13%, 'P': 3.8%, 'S': 6.33%, 'T': 1.27%, 'W': 0%, 'Y': 5.06%, 'V': 6.33%

Missing Amino Acid(s)

C, H, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9486.44 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	99.873	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	25.906	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.07	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.657	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.426	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.004	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.418, 0.165, 0.342 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.152	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5960, 5960	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, Candida spp., Cryptococcus neoformans, M.massiliense (Gram-positive/Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-biofilm, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Chemotaxis, Cytotoxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Guilhelmelli F, Vilela N, Smidt KS, et al. Activity of Scorpion Venom-Derived Antifungal Peptides against Planktonic Cells of Candida spp. and Cryptococcus neoformans and Candida albicans Biofilms. Front Microbiol. 2016;7:1844. Published 2016. doi:10.3389/fmicb.2016.01844

PMID: 27917162

Citation 2: Marques-Neto LM, Trentini MM, das Neves RC, et al. Antimicrobial and Chemotactic Activity of Scorpion-Derived Peptide, ToAP2, against Mycobacterium massiliensis. Toxins (Basel). 2018;10(6). Published 2018 May 30. doi:10.3390/toxins10060219

PMID: 29848960

5.2 Protein Sequence Databases

UniProt: A0A1D3IXJ5

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A1D3IXJ5

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	LT576030	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download