AMPDB_134 | Basic phospholipase A2 F17

PEPTIDE SUMMARY

Basic phospholipase A2 F17

1 General Description

AMPDB ID: AMPDB_134

Protein Names: Basic phospholipase A2 F17 (svPLA2) (EC 3.1.1.4) (CdtF17) (Phosphatidylcholine 2-acylhydrolase)

Protein Family: Phospholipase A2 family; Group II subfamily; D49 sub-subfamily

Gene Name: Nil

Source Organism: Crotalus durissus terrificus (South American rattlesnake)

Protein Length: 121 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

HLLQFNKMLKFETRKNAVPFYAFGCYCGWGGQRRPKDATDRCCFVHDCCYEKVTKCNTKWDFYRYSLKSGYITCGKGTWCKEQICECDRVAAECLRRSLSTYKNEYMFYPDSRCREPSETC

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 10, 'N': 4, 'D': 6, 'C': 14, 'Q': 3, 'E': 8, 'G': 7, 'H': 2, 'I': 2, 'L': 6, 'K': 11, 'M': 2, 'F': 7, 'P': 4, 'S': 6, 'T': 8, 'W': 3, 'Y': 9, 'V': 4

Frequencies of Amino Acids

'A': 4.13%, 'R': 8.26%, 'N': 3.31%, 'D': 4.96%, 'C': 11.57%, 'Q': 2.48%, 'E': 6.61%, 'G': 5.79%, 'H': 1.65%, 'I': 1.65%, 'L': 4.96%, 'K': 9.09%, 'M': 1.65%, 'F': 5.79%, 'P': 3.31%, 'S': 4.96%, 'T': 6.61%, 'W': 2.48%, 'Y': 7.44%, 'V': 3.31%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, I, M

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	14368.5 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	39.504	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	59.283	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.709	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.695	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.424	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.318	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.256, 0.174, 0.174 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.157	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	29910, 30785	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Xanthomonas axonopodis (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

Hydrolase

4.4 Inhibitory Effect

Blood coagulation cascade inhibiting toxin

4.5 Other Biological Activity

Toxin, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Oliveira DG, Toyama MH, Novello JC, et al. Structural and functional characterization of basic PLA2 isolated from Crotalus durissus terrificus venom. J Protein Chem. 2002;21(3):161-8. Published 2002 Mar. doi:10.1023/a:1015320616206

PMID: 12018617

5.2 Protein Sequence Databases

UniProt: P0CAS7

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0CAS7

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001211, IPR033112, IPR016090, IPR036444, IPR033113

PANTHER: PTHR11716

PROSITE: PS00119, PS00118

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download