AMPDB_132 | Thiocillin GE37468

PEPTIDE SUMMARY

Thiocillin GE37468

1 General Description

AMPDB ID: AMPDB_132

Protein Names: Thiocillin GE37468 (Antibiotic GE37468)

Protein Family: Thiocillin family

Gene Name: getA

Source Organism: Streptomyces sp

Protein Length: 57 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MGNNEEYFIDVNDLSIDVFDVVEQGGAVTALTADHGMPEVGASTNCFCYICCSCSSN

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 4, 'R': 0, 'N': 5, 'D': 5, 'C': 5, 'Q': 1, 'E': 4, 'G': 5, 'H': 1, 'I': 3, 'L': 2, 'K': 0, 'M': 2, 'F': 3, 'P': 1, 'S': 5, 'T': 3, 'W': 0, 'Y': 2, 'V': 6

Frequencies of Amino Acids

'A': 7.02%, 'R': 0%, 'N': 8.77%, 'D': 8.77%, 'C': 8.77%, 'Q': 1.75%, 'E': 7.02%, 'G': 8.77%, 'H': 1.75%, 'I': 5.26%, 'L': 3.51%, 'K': 0%, 'M': 3.51%, 'F': 5.26%, 'P': 1.75%, 'S': 8.77%, 'T': 5.26%, 'W': 0%, 'Y': 3.51%, 'V': 10.53%

Missing Amino Acid(s)

K, R, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, P, Q

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6057.66 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	71.754	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	29.211	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.179	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.45	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	3.332	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-9.213	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.281, 0.281, 0.211 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.088	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3230	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

B.subtilis (Gram-positive), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-MRSA, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Young TS, Walsh CT, Walsh CT. Identification of the thiazolyl peptide GE37468 gene cluster from Streptomyces ATCC 55365 and heterologous expression in Streptomyces lividans. Proc Natl Acad Sci U S A. 2011;108(32):13053-8. Published 2011 Aug 9. doi:10.1073/pnas.1110435108

PMID: 21788474

Citation 2: Stella S, Montanini N, Le Monnier F, et al. Antibiotic GE37468 A: a new inhibitor of bacterial protein synthesis. I. Isolation and characterization. J Antibiot (Tokyo). 1995;48(8):780-6. Published 1995 Aug. doi:10.7164/antibiotics.48.780

PMID: 7592021

Citation 3: Ferrari P, Colombo L, Stella S, et al. Antibiotic GE37468 A: a novel inhibitor of bacterial protein synthesis. II. Structure elucidation. J Antibiot (Tokyo). 1995;48(11):1304-11. Published 1995 Nov. doi:10.7164/antibiotics.48.1304

PMID: 8557573

5.2 Protein Sequence Databases

UniProt: P0C8P9

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0C8P9

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	JN052143	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download