AMPDB_128 | L-amino-acid oxidase

PEPTIDE SUMMARY

L-amino-acid oxidase

1 General Description

AMPDB ID: AMPDB_128

Protein Names: L-amino-acid oxidase (BpirLAAO-I) (LAO) (EC 1.4.3.2)

Protein Family: Flavin monoamine oxidase family; FIG1 subfamily

Gene Name: Nil

Source Organism: Bothrops pirajai (Piraja`s lancehead)

Protein Length: 49 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

ADDKNPLEEFRETNYEVFLEIAKNGLKATSNPKRVVIVGAGMAGLSAAY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 2, 'N': 4, 'D': 2, 'C': 0, 'Q': 0, 'E': 5, 'G': 4, 'H': 0, 'I': 2, 'L': 4, 'K': 4, 'M': 1, 'F': 2, 'P': 2, 'S': 2, 'T': 2, 'W': 0, 'Y': 2, 'V': 4

Frequencies of Amino Acids

'A': 14.29%, 'R': 4.08%, 'N': 8.16%, 'D': 4.08%, 'C': 0%, 'Q': 0%, 'E': 10.2%, 'G': 8.16%, 'H': 0%, 'I': 4.08%, 'L': 8.16%, 'K': 8.16%, 'M': 2.04%, 'F': 4.08%, 'P': 4.08%, 'S': 4.08%, 'T': 4.08%, 'W': 0%, 'Y': 4.08%, 'V': 8.16%

Missing Amino Acid(s)

C, H, Q, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	5299 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	85.714	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	10.306	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.253	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.606	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.855	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.995	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.286, 0.245, 0.347 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.082	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 2980	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), P.aeruginosa (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-parasitic, Anti-gram-negative

4.3 Enzymatic Activity

Oxidoreductase

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Toxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Izidoro LF, Ribeiro MC, Souza GR, et al. Biochemical and functional characterization of an L-amino acid oxidase isolated from Bothrops pirajai snake venom. Bioorg Med Chem. 2006;14(20):7034-43. Published 2006 Oct 15. doi:10.1016/j.bmc.2006.06.025

PMID: 16809041

5.2 Protein Sequence Databases

UniProt: P0C2D1

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P0C2D1

5.4 Nucleotide Sequence Databases

No entries found in GenBank or EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR036188

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download