AMPDB_121 | Ribonuclease K6

PEPTIDE SUMMARY

Ribonuclease K6

1 General Description

AMPDB ID: AMPDB_121

Protein Names: Ribonuclease K6 (RNase K6) (EC 3.1.27.-) (K6b) (Ribonuclease K2) (RNase K2)

Protein Family: Pancreatic ribonuclease family

Gene Name: RNASE6 RK6B RNS6

Source Organism: Bos taurus (Bovine)

Protein Length: 154 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MGPHLLGRSSLLLLLLGMWWSVRPLCAVPKGLTKARWFEIQHIQPRLLQCNKAMSGVNNYTQHCKPENTFLHNVFQDVTAVCDMPNIICKNGRHNCHQSPKPVNLTQCNFIAGRYPDCRYHDDAQYKFFIVACDPPQKTDPPYHLVPVHLDKVV

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 7, 'R': 7, 'N': 10, 'D': 8, 'C': 9, 'Q': 9, 'E': 2, 'G': 7, 'H': 9, 'I': 6, 'L': 16, 'K': 9, 'M': 4, 'F': 6, 'P': 14, 'S': 5, 'T': 6, 'W': 3, 'Y': 5, 'V': 12

Frequencies of Amino Acids

'A': 4.55%, 'R': 4.55%, 'N': 6.49%, 'D': 5.19%, 'C': 5.84%, 'Q': 5.84%, 'E': 1.3%, 'G': 4.55%, 'H': 5.84%, 'I': 3.9%, 'L': 10.39%, 'K': 5.84%, 'M': 2.6%, 'F': 3.9%, 'P': 9.09%, 'S': 3.25%, 'T': 3.9%, 'W': 1.95%, 'Y': 3.25%, 'V': 7.79%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	17660.6 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	82.857	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	57.037	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.271	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.591	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.655	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.259	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.312, 0.234, 0.188 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.091	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	23950, 24450	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative), E.faecalis (Gram-positive), E.faecium (Gram-positive), M.luteus (Gram-negative), P.aeruginosa (Gram-negative), S.aureus (Gram-positive), S.saprophyticus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Endonuclease, Hydrolase, Nuclease

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Pietrowski D, FÃ¶rster M, FÃ¶rster M. Complete cDNA sequence and amino acid analysis of a bovine ribonuclease K6 gene. DNA Seq. 2000;11(3-4):365-71. Published 2000. doi:10.3109/10425170009033257

PMID: 11092753

Citation 2: Irie M, Nitta R, Ohgi K, et al. Primary structure of a non-secretory ribonuclease from bovine kidney. J Biochem. 1988;104(2):289-96. Published 1988 Aug. doi:10.1093/oxfordjournals.jbchem.a122460

PMID: 3182769

Citation 3: Niwata Y, Ohgi K, Sanda A, et al. Purification and properties of bovine kidney ribonucleases. J Biochem. 1985;97(3):923-34. Published 1985 Mar. doi:10.1093/oxfordjournals.jbchem.a135134

PMID: 3926759

Citation 4: Rosenberg HF, Dyer KD, Dyer KD. Molecular cloning and characterization of a novel human ribonuclease (RNase k6): increasing diversity in the enlarging ribonuclease gene family. Nucleic Acids Res. 1996;24(18):3507-13. Published 1996 Sep 15. doi:10.1093/nar/24.18.3507

PMID: 8836175

5.2 Protein Sequence Databases

UniProt: P08904

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P08904

5.4 Nucleotide Sequence Databases