AMPDB_12 | Bombinin-like peptides

PEPTIDE SUMMARY

Bombinin-like peptides

1 General Description

AMPDB ID: AMPDB_12

Protein Names: Bombinin-like peptides [Cleaved into: Bombinin-BO1; Bombinin H-BO1]

Protein Family: Bombinin family

Gene Name: BLP8-BH9

Source Organism: Bombina orientalis (Oriental fire-bellied toad)

Protein Length: 132 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNFKYIIAVSFLIASAYARSEEYDIQSLSQRDVLEEESLRKIRGIGSAILSAGKSIIKGLAKGLAEHFGKRTAEDHEVMKRLEAAMRDLDSLDYPEEASERETRGFNQEEKEKRIIGPVLGLVGKALGGLLG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 13, 'R': 10, 'N': 2, 'D': 6, 'C': 0, 'Q': 3, 'E': 16, 'G': 13, 'H': 2, 'I': 11, 'L': 15, 'K': 10, 'M': 3, 'F': 4, 'P': 2, 'S': 11, 'T': 2, 'W': 0, 'Y': 4, 'V': 5

Frequencies of Amino Acids

'A': 9.85%, 'R': 7.58%, 'N': 1.52%, 'D': 4.55%, 'C': 0%, 'Q': 2.27%, 'E': 12.12%, 'G': 9.85%, 'H': 1.52%, 'I': 8.33%, 'L': 11.36%, 'K': 7.58%, 'M': 2.27%, 'F': 3.03%, 'P': 1.52%, 'S': 8.33%, 'T': 1.52%, 'W': 0%, 'Y': 3.03%, 'V': 3.79%

Missing Amino Acid(s)

C, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, N, P, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	14597.7 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	97.652	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	45.853	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.31	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.674	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.839	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-1.796	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.295, 0.212, 0.356 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.061	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	5960, 5960	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, E.coli (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Peng X, Zhou C, Hou X, et al. Molecular characterization and bioactivity evaluation of two novel bombinin peptides from the skin secretion of Oriental fire-bellied toad, Bombina orientalis. Amino Acids. 2018;50(2):241-253. Published 2018 Feb. doi:10.1007/s00726-017-2509-z

PMID: 29098406

5.2 Protein Sequence Databases

UniProt: A0A219CMY0

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A219CMY0

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	LT732575	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR007962

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download