AMPDB_1169 | Heterin-1

PEPTIDE SUMMARY

Heterin-1

1 General Description

AMPDB ID: AMPDB_1169

Protein Names: Heterin-1

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Long chain multifunctional peptide (group 2) family

Gene Name: Nil

Source Organism: Heterometrus spinifer (Asia giant forest scorpion) (Malaysian black scorpion)

Protein Length: 83 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MNGKLLLVSLMVTMLVMQPAEAGVWDWLKKTAKNVWNSDIVKQLKGKAINAAKNYVAEKIGATPSVAGQIPFDEFMDILHYRP

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 9, 'R': 1, 'N': 5, 'D': 4, 'C': 0, 'Q': 3, 'E': 3, 'G': 5, 'H': 1, 'I': 5, 'L': 8, 'K': 9, 'M': 5, 'F': 2, 'P': 4, 'S': 3, 'T': 3, 'W': 3, 'Y': 2, 'V': 8

Frequencies of Amino Acids

'A': 10.84%, 'R': 1.2%, 'N': 6.02%, 'D': 4.82%, 'C': 0%, 'Q': 3.61%, 'E': 3.61%, 'G': 6.02%, 'H': 1.2%, 'I': 6.02%, 'L': 9.64%, 'K': 10.84%, 'M': 6.02%, 'F': 2.41%, 'P': 4.82%, 'S': 3.61%, 'T': 3.61%, 'W': 3.61%, 'Y': 2.41%, 'V': 9.64%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

A, K

Less Occurring Amino Acid(s)

H, R

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9244.95 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	99.88	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	20.73	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.052	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.639	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.978	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.092	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.337, 0.205, 0.301 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.084	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	19480, 19480	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Bacillus megaterium (Gram-positive), Micrococcus luteus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Wu S, Nie Y, Zeng XC, et al. Genomic and functional characterization of three new venom peptides from the scorpion Heterometrus spinifer. Peptides. 2014;53:30-41. Published 2014 Mar. doi:10.1016/j.peptides.2013.12.012

PMID: 24389272

5.2 Protein Sequence Databases

UniProt: A0A0C4G489

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A0C4G489

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	KC538867	GenBank \|\| EMBL
2.	KC538868	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR012526

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download