AMPDB_116 | Histone H1

PEPTIDE SUMMARY

Histone H1

1 General Description

AMPDB ID: AMPDB_116

Protein Names: Histone H1 [Cleaved into: Oncorhyncin II]

Protein Family: Histone H1 H5 family

Gene Name: Nil

Source Organism: Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)

Protein Length: 207 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MAEVAPAPAAAAPAKAPKKKAAAKPKKAGPSVGELIVKAVSASKERSGVSLAALKKSLAAGGYDVEKNNSRVKIAVKSLVTKGTLVQTKGTGASGSFKLNKKAVEAKKPAKKAAAPKAKKVAAKKPAAAKKPKKVAAKKAVAAKKSPKKAKKPATPKKAAKSPKKVKKPAAAAKKAAKSPKKATKAAKPKAAKPKAAKAKKAAPKKK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 58, 'R': 2, 'N': 3, 'D': 1, 'C': 0, 'Q': 1, 'E': 5, 'G': 9, 'H': 0, 'I': 2, 'L': 7, 'K': 63, 'M': 1, 'F': 1, 'P': 19, 'S': 13, 'T': 6, 'W': 0, 'Y': 1, 'V': 15

Frequencies of Amino Acids

'A': 28.02%, 'R': 0.97%, 'N': 1.45%, 'D': 0.48%, 'C': 0%, 'Q': 0.48%, 'E': 2.42%, 'G': 4.35%, 'H': 0%, 'I': 0.97%, 'L': 3.38%, 'K': 30.43%, 'M': 0.48%, 'F': 0.48%, 'P': 9.18%, 'S': 6.28%, 'T': 2.9%, 'W': 0%, 'Y': 0.48%, 'V': 7.25%

Missing Amino Acid(s)

C, H, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, F, M, Q, Y

Hydrophobic Amino Acid(s) Count

112

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	20803.3 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	65.99	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	24.756	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.637	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.641	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	11.756	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	58.988	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.126, 0.213, 0.343 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.01	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1490	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Mezquita J, Connor W, Winkfein RJ, et al. An H1 histone gene from rainbow trout (Salmo gairdnerii). J Mol Evol. 1984-1985;21(3):209-19. Published 1984-1985. doi:10.1007/BF02102355

PMID: 6443128

Citation 2: Fernandes JM, Molle G, Kemp GD, et al. Isolation and characterisation of oncorhyncin II, a histone H1-derived antimicrobial peptide from skin secretions of rainbow trout, Oncorhynchus mykiss. Dev Comp Immunol. 2004;28(2):127-38. Published 2004 Feb. doi:10.1016/s0145-305x(03)00120-4

PMID: 12969798

5.2 Protein Sequence Databases

UniProt: P06350

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: P06350

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	X02624	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR005819, IPR005818, IPR036388, IPR036390

PANTHER: Not found

PROSITE: PS51504

5.8 Genome Annotation Databases

Ensembl: ENSGT00950000183089

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: ENSGT00950000183089

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download