AMPDB_1108 | Fungal defensin scedosporisin-2

PEPTIDE SUMMARY

Fungal defensin scedosporisin-2

1 General Description

AMPDB ID: AMPDB_1108

Protein Names: Fungal defensin scedosporisin-2 (fDEF)

Protein Family: Invertebrate defensin family

Gene Name: SAPIO_CDS6842

Source Organism: Pseudallescheria apiosperma (Scedosporium apiospermum)

Protein Length: 94 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKFSNISIAALFTILASTAMAAPAADSPDSIVAREPAPVEETYEAPSGLEKRGFGCPGSEKKCHNHCKSVKGYKGGYCDGPYIPFVGRPRCKCY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 11, 'R': 4, 'N': 2, 'D': 3, 'C': 6, 'Q': 0, 'E': 6, 'G': 9, 'H': 2, 'I': 5, 'L': 3, 'K': 8, 'M': 2, 'F': 4, 'P': 9, 'S': 8, 'T': 3, 'W': 0, 'Y': 5, 'V': 4

Frequencies of Amino Acids

'A': 11.7%, 'R': 4.26%, 'N': 2.13%, 'D': 3.19%, 'C': 6.38%, 'Q': 0%, 'E': 6.38%, 'G': 9.57%, 'H': 2.13%, 'I': 5.32%, 'L': 3.19%, 'K': 8.51%, 'M': 2.13%, 'F': 4.26%, 'P': 9.57%, 'S': 8.51%, 'T': 3.19%, 'W': 0%, 'Y': 5.32%, 'V': 4.26%

Missing Amino Acid(s)

Q, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, M, N

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	10047.5 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	57.234	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	57.33	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.283	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.45	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.365	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	2.813	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.223, 0.298, 0.234 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.096	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	7450, 7825	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Staphylococcus aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-MRSA, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytotoxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Vandeputte P, Ghamrawi S, Rechenmann M, et al. Draft Genome Sequence of the Pathogenic Fungus Scedosporium apiospermum. Genome Announc. 2014;2(5). Published 2014 Oct 2. doi:10.1128/genomeA.00988-14

PMID: 25278533

Citation 2: Wu J, Liu S, Wang H, et al. Invasive fungi-derived defensins kill drug-resistant bacterial pathogens. Peptides. 2018;99:82-91. Published 2018 Jan. doi:10.1016/j.peptides.2017.11.009

PMID: 29174563

5.2 Protein Sequence Databases

UniProt: A0A084G2W8

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A084G2W8

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	JOWA01000108	GenBank \|\| EMBL

CCDS: Not found

RefSeq: XP_016641479.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: sapo:SAPIO_CDS6842

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download