AMPDB_11 | Centrocin 2

PEPTIDE SUMMARY

Centrocin 2

1 General Description

AMPDB ID: AMPDB_11

Protein Names: Centrocin 2 (EeCentrocin 2) [Cleaved into: Centrocin 2; heavy chain; Centrocin 2; light chain]

Protein Family: Nil

Gene Name: Nil

Source Organism: Echinus esculentus (Sea urchin)

Protein Length: 121 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MMIKIAVVLCAVMATSMVFANDVKEQELADLLDLLISEEVSSPDDAVAESWGHKLRSSWNKVKHAVKKGAGYASGACRVLGHSPQEARAKVLEAFPEMKESDLDEEQVGKYCAVAHAIHGR

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 17, 'R': 4, 'N': 2, 'D': 7, 'C': 3, 'Q': 3, 'E': 11, 'G': 7, 'H': 5, 'I': 4, 'L': 10, 'K': 10, 'M': 5, 'F': 2, 'P': 3, 'S': 10, 'T': 1, 'W': 2, 'Y': 2, 'V': 13

Frequencies of Amino Acids

'A': 14.05%, 'R': 3.31%, 'N': 1.65%, 'D': 5.79%, 'C': 2.48%, 'Q': 2.48%, 'E': 9.09%, 'G': 5.79%, 'H': 4.13%, 'I': 3.31%, 'L': 8.26%, 'K': 8.26%, 'M': 4.13%, 'F': 1.65%, 'P': 2.48%, 'S': 8.26%, 'T': 0.83%, 'W': 1.65%, 'Y': 1.65%, 'V': 10.74%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	13151.1 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	90.331	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	46.265	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.086	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.606	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.993	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.715	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.273, 0.182, 0.355 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.05	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	13980, 14105	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Solstad RG, Li C, Isaksson J, et al. Novel Antimicrobial Peptides EeCentrocins 1, 2 and EeStrongylocin 2 from the Edible Sea Urchin Echinus esculentus Have 6-Br-Trp Post-Translational Modifications. PLoS One. 2016;11(3):e0151820. Published 2016. doi:10.1371/journal.pone.0151820

PMID: 27007817

5.2 Protein Sequence Databases

UniProt: A0A144LVL3

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A144LVL3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	KR494263	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download