AMPDB_1086 | Fungal defensin triintsin

PEPTIDE SUMMARY

Fungal defensin triintsin

1 General Description

AMPDB ID: AMPDB_1086

Protein Names: Fungal defensin triintsin

Protein Family: Invertebrate defensin family

Gene Name: H109_04975

Source Organism: Trichophyton interdigitale (strain MR816)

Protein Length: 85 AA

Protein Existence: Inferred from homology

2 Protein Sequence & Composition

2.1 Sequence

MQFTKLATVLIVSLMGSAAIAAPSVDNAPAVAAEEVAAAPAENLEKRGFGCPLNERECHSHCQSIGRKFGYCGGTLRLTCICGKE

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 13, 'R': 4, 'N': 3, 'D': 1, 'C': 6, 'Q': 2, 'E': 7, 'G': 8, 'H': 2, 'I': 4, 'L': 7, 'K': 4, 'M': 2, 'F': 3, 'P': 4, 'S': 5, 'T': 4, 'W': 0, 'Y': 1, 'V': 5

Frequencies of Amino Acids

'A': 15.29%, 'R': 4.71%, 'N': 3.53%, 'D': 1.18%, 'C': 7.06%, 'Q': 2.35%, 'E': 8.24%, 'G': 9.41%, 'H': 2.35%, 'I': 4.71%, 'L': 8.24%, 'K': 4.71%, 'M': 2.35%, 'F': 3.53%, 'P': 4.71%, 'S': 5.88%, 'T': 4.71%, 'W': 0%, 'Y': 1.18%, 'V': 5.88%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8882.27 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	82.824	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	40.884	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.153	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.547	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.209	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.181	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.235, 0.235, 0.341 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.047	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1865	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, K.pneumoniae (Gram-negative), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-MRSA, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Persinoti GF, Martinez DA, Li W, et al. Whole-Genome Analysis Illustrates Global Clonal Population Structure of the Ubiquitous Dermatophyte Pathogen Trichophyton rubrum. Genetics. 2018;208(4):1657-1669. Published 2018 Apr. doi:10.1534/genetics.117.300573

PMID: 29467168

Citation 2: Shen B, Song J, Zhao Y, et al. Triintsin, a human pathogenic fungus-derived defensin with broad-spectrum antimicrobial activity. Peptides. 2018;107:61-67. Published 2018 Sep. doi:10.1016/j.peptides.2018.08.003

PMID: 30102941

5.2 Protein Sequence Databases

UniProt: A0A059J5P2

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: A0A059J5P2

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AOKY01000319	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001542, IPR036574

PANTHER: Not found

PROSITE: PS51378

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download