AMPDB_1078 | M-myrmicitoxin

1 General Description

AMPDB ID: AMPDB_1078

Protein Names: M-myrmicitoxin(01)-Tb1a (M-MYRTX(01)-Tb1a) (Ant peptide P16) (Bicarinalin) (Bicarinaline) (M-myrmicitoxin-Tb1a) (M-MYRTX-Tb1a)

Protein Family: Formicidae venom precursor-01 superfamily

Gene Name: Nil

Source Organism: Tetramorium bicarinatum (Tramp ant)

Protein Length: 79 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MKLSFLSLVLAIILVMALMYTPHAEAKAWADADADATAAADADADAVADALADAVAKIKIPWGKVKDFLVGGMKAVGKK

FASTA format

Counts of Amino Acids

'A': 21, 'R': 0, 'N': 0, 'D': 9, 'C': 0, 'Q': 0, 'E': 1, 'G': 4, 'H': 1, 'I': 4, 'L': 8, 'K': 9, 'M': 4, 'F': 2, 'P': 2, 'S': 2, 'T': 2, 'W': 2, 'Y': 1, 'V': 7

Frequencies of Amino Acids

'A': 26.58%, 'R': 0%, 'N': 0%, 'D': 11.39%, 'C': 0%, 'Q': 0%, 'E': 1.27%, 'G': 5.06%, 'H': 1.27%, 'I': 5.06%, 'L': 10.13%, 'K': 11.39%, 'M': 5.06%, 'F': 2.53%, 'P': 2.53%, 'S': 2.53%, 'T': 2.53%, 'W': 2.53%, 'Y': 1.27%, 'V': 8.86%

Missing Amino Acid(s)

C, N, Q, R

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

E, H, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8171.67 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	111.519	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	-6.175	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.565	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.534	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	5.753	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-0.909	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.304, 0.101, 0.43 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.063	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	12490, 12490	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

A.niger, B.subtilis (Gram-positive), C.albicans, C.sakazakii (Gram-negative), E.coli (Gram-negative), E.hirae (Gram-positive), Fungi, G.candidum, H.pylori (Gram-negative), L.infantum, P.aeruginosa (Gram-negative), S.aureus (Gram-positive), S.cerevisiae, S.enterica (Gram-negative), S.xylosus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-MRSA, Anti-candida, Anti-parasitic, Anti-yeast, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Cytotoxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: TÃ©nÃ© N, BonnafÃ© E, Berger F, et al. Biochemical and biophysical combined study of bicarinalin, an ant venom antimicrobial peptide. Peptides. 2016;79:103-13. Published 2016 May. doi:10.1016/j.peptides.2016.04.001

PMID: 27058430

Citation 2: Bouzid W, Klopp C, Verdenaud M, et al. Profiling the venom gland transcriptome of Tetramorium bicarinatum (Hymenoptera: Formicidae): the first transcriptome analysis of an ant species. Toxicon. 2013;70:70-81. Published 2013 Aug. doi:10.1016/j.toxicon.2013.03.010

PMID: 23584016

Citation 3: Rifflet A, Gavalda S, TÃ©nÃ© N, et al. Identification and characterization of a novel antimicrobial peptide from the venom of the ant Tetramorium bicarinatum. Peptides. 2012;38(2):363-70. Published 2012 Dec. doi:10.1016/j.peptides.2012.08.018

PMID: 22960382

Citation 4: Guzman J, TÃ©nÃ© N, Touchard A, et al. Anti-Helicobacter pylori Properties of the Ant-Venom Peptide Bicarinalin. Toxins (Basel). 2017;10(1). Published 2017 Dec 29. doi:10.3390/toxins10010021

PMID: 29286296

Citation 5: Touchard A, Aili SR, Fox EG, et al. The Biochemical Toxin Arsenal from Ant Venoms. Toxins (Basel). 2016;8(1). Published 2016 Jan 20. doi:10.3390/toxins8010030

PMID: 26805882

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: W8GNV3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	KF929552	GenBank \|\| EMBL
2.	JZ168535	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download