AMPDB_1075 | Antimicrobial peptide TsAP-2

1 General Description

AMPDB ID: AMPDB_1075

Protein Names: Antimicrobial peptide TsAP-2 (Non-disulfide-bridged peptide 4.23) (NDBP-4.23)

Protein Family: Non-disulfide-bridged peptide (NDBP) superfamily; Short antimicrobial peptide (group 4) family

Gene Name: Nil

Source Organism: Tityus serrulatus (Brazilian scorpion)

Protein Length: 73 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MQIKHLITIFFLVLIVADHCHAFLGMIPGLIGGLISAFKGRRKREITSQIEQYRNLQKREAELENLLANLPVY

FASTA format

Counts of Amino Acids

'A': 5, 'R': 5, 'N': 3, 'D': 1, 'C': 1, 'Q': 4, 'E': 5, 'G': 5, 'H': 3, 'I': 9, 'L': 11, 'K': 4, 'M': 2, 'F': 4, 'P': 2, 'S': 2, 'T': 2, 'W': 0, 'Y': 2, 'V': 3

Frequencies of Amino Acids

'A': 6.85%, 'R': 6.85%, 'N': 4.11%, 'D': 1.37%, 'C': 1.37%, 'Q': 5.48%, 'E': 6.85%, 'G': 6.85%, 'H': 4.11%, 'I': 12.33%, 'L': 15.07%, 'K': 5.48%, 'M': 2.74%, 'F': 5.48%, 'P': 2.74%, 'S': 2.74%, 'T': 2.74%, 'W': 0%, 'Y': 2.74%, 'V': 4.11%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, D

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8390.99 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	125.616	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	45.644	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.238	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.505	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.832	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	3.215	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.397, 0.164, 0.315 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.082	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 2980	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

C.albicans, Candida spp., Cryptococcus neoformans, E.faecalis (Gram-positive), S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-MRSA, Anti-biofilm, Anti-candida, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Cytolysis, Anti-cancer, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Guo X, Ma C, Du Q, et al. Two peptides, TsAP-1 and TsAP-2, from the venom of the Brazilian yellow scorpion, Tityus serrulatus: evaluation of their antimicrobial and anticancer activities. Biochimie. 2013;95(9):1784-94. Published 2013 Sep. doi:10.1016/j.biochi.2013.06.003

PMID: 23770440

Citation 2: Guilhelmelli F, Vilela N, Smidt KS, et al. Activity of Scorpion Venom-Derived Antifungal Peptides against Planktonic Cells of Candida spp. and Cryptococcus neoformans and Candida albicans Biofilms. Front Microbiol. 2016;7:1844. Published 2016. doi:10.3389/fmicb.2016.01844

PMID: 27917162

Citation 3: Daniele-Silva A, Machado RJ, Monteiro NK, et al. Stigmurin and TsAP-2 from Tityus stigmurus scorpion venom: Assessment of structure and therapeutic potential in experimental sepsis. Toxicon. 2016;121:10-21. Published 2016 Oct. doi:10.1016/j.toxicon.2016.08.016

PMID: 27567704

Citation 4: Almaaytah A, Albalas Q, Albalas Q. Scorpion venom peptides with no disulfide bridges: a review. Peptides. 2014;51:35-45. Published 2014 Jan. doi:10.1016/j.peptides.2013.10.021

PMID: 24184590

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: S6D3A7

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	HF677517	GenBank \|\| EMBL

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download