AMPDB_1073 | Microcin E492

1 General Description

AMPDB ID: AMPDB_1073

Protein Names: Microcin E492 (MccE492)

Protein Family: Class IIa microcin family

Gene Name: mceA

Source Organism: Klebsiella pneumoniae

Protein Length: 99 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MREISQKDLNLAFGAGETDPNTQLLNDLGNNMAWGAALGAPGGLGSAALGAAGGALQTVGQGLIDHGPVNVPIPVLIGPSWNGSGSGYNSATSSSGSGS

FASTA format

Counts of Amino Acids

'A': 12, 'R': 1, 'N': 8, 'D': 4, 'C': 0, 'Q': 4, 'E': 2, 'G': 20, 'H': 1, 'I': 4, 'L': 11, 'K': 1, 'M': 2, 'F': 1, 'P': 6, 'S': 11, 'T': 4, 'W': 2, 'Y': 1, 'V': 4

Frequencies of Amino Acids

'A': 12.12%, 'R': 1.01%, 'N': 8.08%, 'D': 4.04%, 'C': 0%, 'Q': 4.04%, 'E': 2.02%, 'G': 20.2%, 'H': 1.01%, 'I': 4.04%, 'L': 11.11%, 'K': 1.01%, 'M': 2.02%, 'F': 1.01%, 'P': 6.06%, 'S': 11.11%, 'T': 4.04%, 'W': 2.02%, 'Y': 1.01%, 'V': 4.04%

Missing Amino Acid(s)

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

F, H, K, R, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	9561.51 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	82.929	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	21.78	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.021	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.517	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.043	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-3.907	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.232, 0.455, 0.273 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.04	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	12490, 12490	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

E.cloacae (Gram-negative), E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Anti-gram-negative

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Lagos R, Villanueva JE, Monasterio O, et al. Identification and properties of the genes encoding microcin E492 and its immunity protein. J Bacteriol. 1999;181(1):212-7. Published 1999 Jan. doi:10.1128/JB.181.1.212-217.1999

PMID: 9864332

Citation 2: Pons AM, Zorn N, Vignon D, et al. Microcin E492 is an unmodified peptide related in structure to colicin V. Antimicrob Agents Chemother. 2002;46(1):229-30. Published 2002 Jan. doi:10.1128/AAC.46.1.229-230.2002

PMID: 11751140

Citation 3: Destoumieux-GarzÃ³n D, Thomas X, Santamaria M, et al. Microcin E492 antibacterial activity: evidence for a TonB-dependent inner membrane permeabilization on Escherichia coli. Mol Microbiol. 2003;49(4):1031-41. Published 2003 Aug. doi:10.1046/j.1365-2958.2003.03610.x

PMID: 12890026

Citation 4: Thomas X, Destoumieux-GarzÃ³n D, Peduzzi J, et al. Siderophore peptide, a new type of post-translationally modified antibacterial peptide with potent activity. J Biol Chem. 2004;279(27):28233-42. Published 2004 Jul 2. doi:10.1074/jbc.M400228200

PMID: 15102848

Citation 5: Lagos R, Wilkens M, Vergara C, et al. Microcin E492 forms ion channels in phospholipid bilayer membrane. FEBS Lett. 1993;321(2-3):145-8. Published 1993 Apr 26. doi:10.1016/0014-5793(93)80096-d

PMID: 7682973

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q9Z4N4

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF063590	GenBank \|\| EMBL

RefSeq: WP_071785591.1

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download