AMPDB_1072 | Neutrophil antibiotic peptide NP-3B
PEPTIDE SUMMARY
Neutrophil antibiotic peptide NP-3B
1 General Description
AMPDB ID: AMPDB_1072
Protein Names: Neutrophil antibiotic peptide NP-3B (RatNP-3b) (Neutrophil defensin 3)
Protein Family: Alpha-defensin family
Gene Name: Nil
Source Organism: Rattus norvegicus (Rat)
Protein Length: 87 AA
Protein Existence: Evidence at protein level
2 Protein Sequence & Composition
2.1 Sequence
MRTLILLTTLLLLALHTQAESPQGSTKEAPDEEQDISVFFGGDKGTALQDAAVKAGVTCSCRTSSCRFGERLSGACRLNGRIYRLCC
FASTA format
2.2 Composition
Counts of Amino Acids
'A': 8, 'R': 7, 'N': 1, 'D': 4, 'C': 6, 'Q': 4, 'E': 5, 'G': 8, 'H': 1, 'I': 3, 'L': 12, 'K': 3, 'M': 1, 'F': 3, 'P': 2, 'S': 7, 'T': 8, 'W': 0, 'Y': 1, 'V': 3
Frequencies of Amino Acids
'A': 9.2%, 'R': 8.05%, 'N': 1.15%, 'D': 4.6%, 'C': 6.9%, 'Q': 4.6%, 'E': 5.75%, 'G': 9.2%, 'H': 1.15%, 'I': 3.45%, 'L': 13.79%, 'K': 3.45%, 'M': 1.15%, 'F': 3.45%, 'P': 2.3%, 'S': 8.05%, 'T': 9.2%, 'W': 0%, 'Y': 1.15%, 'V': 3.45%
Missing Amino Acid(s)
W
Most Occurring Amino Acid(s)
L
Less Occurring Amino Acid(s)
H, M, N, Y
Hydrophobic Amino Acid(s) Count
40
Hydrophilic Amino Acid(s) Count
47
Basic Amino Acid(s) Count
9
Acidic Amino Acid(s) Count
11
Modified Amino Acid(s) Count
0
Modified Amino Acid(s) Frequencies
0
Computed by biopython (version 1.79) & proteinAnalysis (version 1)
3 Physicochemical Properties
Sl. No. Properties Values Reference
1. Molecular Mass 9352.74 Da Computed by ProtParam module (biopython 1.79)
2. Aliphatic Index 86.437 Computed by ProtParam module (biopython 1.79)
3. Instability Index (Half Life) 40.889 Computed by ProtParam module (biopython 1.79)
4. Hydrophobicity (GRAVY) -0.033 Computed by ProtParam module (biopython 1.79)
5. Hydrophobic Moment 0.718 Computed by ProtParam module (biopython 1.79)
6. Isoelectric Point 7.758 Computed by ProtParam module (biopython 1.79)
7. Charge (at pH 7) 0.726 Computed by ProtParam module (biopython 1.79)
8. Secondary Structure Fraction 0.253, 0.207, 0.299 [Helix, Turn, Sheet] Computed by ProtParam module (biopython 1.79)
9. Aromaticity 0.046 Computed by ProtParam module (biopython 1.79)
10. Molar Extinction Coefficient (cysteine|cystine) 1490, 1865 Computed by ProtParam module (biopython 1.79)
4 Activity Details
4.1 Target Organism(s)
S.aureus (Gram-positive)
4.2 Antimicrobial Activity
Antibiotic, Antimicrobial, Defensin, Fungicide, Anti-gram-Positive
4.3 Enzymatic Activity
Not found
4.4 Inhibitory Effect
Not found
4.5 Other Biological Activity
Non-hemolytic, Non-ribosomal
Activity data manually curated from Literature and UniProt
5 Database Cross-references
5.1 Literature Database
5.1.1 PubMed
Citation 1: Eisenhauer PB, Harwig SS, Szklarek D, et al. Purification and antimicrobial properties of three defensins from rat neutrophils. Infect Immun. 1989;57(7):2021-7. Published 1989 Jul. doi:10.1128/iai.57.7.2021-2027.1989
PMID: 2543629
5.2 Protein Sequence Databases
UniProt: Q9Z1F1
5.3 3D Structure Databases
No PDB Ids found
AlphaFoldDB: Q9Z1F1
5.4 Nucleotide Sequence Databases
Sl. no. Accession(s) Access Link(s)
1. U50354 GenBank || EMBL
CCDS: Not found
5.5 Protein-Protein Interaction Databases
IntAct: Not found
MINT: Not found
DIP: Not found
BioGRID: Not found
5.6 Ligand Databases
BindingDB: Not found
DrugBank: Not found
ChEMBL: Not found
5.7 Family & Domain Databases
PANTHER: PTHR11876
PROSITE: PS00269
5.8 Genome Annotation Databases
5.9 Phylogenomic Databases
5.10 Enzyme & Pathway Databases
BRENDA: Not found
BioCyc: Not found
5.11 Protein-RNA Interaction Databases
RNAct: Not found




© 2023 B&BL, DoAS, IIIT-A, UP-211015, India