AMPDB_1071 | Cystatin-9

1 General Description

AMPDB ID: AMPDB_1071

Protein Names: Cystatin-9 (Testatin)

Protein Family: Cystatin family

Gene Name: Cst9 Cresp

Source Organism: Mus musculus (Mouse)

Protein Length: 137 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

MSCPLRKKALPLTMLLLLLSFHVLITPVSKANKETNRSVHFIPTVEFAVNTFNQESQDEYAYRMEHIMSSWREKVNFPTVYSMRLQLRRTICKKFEESLDICPFQESHGLNNTFTCLFTVGTYPWITKFKLFRSVCS

FASTA format

Counts of Amino Acids

'A': 4, 'R': 8, 'N': 7, 'D': 2, 'C': 5, 'Q': 4, 'E': 9, 'G': 2, 'H': 4, 'I': 6, 'L': 15, 'K': 9, 'M': 5, 'F': 11, 'P': 7, 'S': 12, 'T': 12, 'W': 2, 'Y': 4, 'V': 9

Frequencies of Amino Acids

'A': 2.92%, 'R': 5.84%, 'N': 5.11%, 'D': 1.46%, 'C': 3.65%, 'Q': 2.92%, 'E': 6.57%, 'G': 1.46%, 'H': 2.92%, 'I': 4.38%, 'L': 10.95%, 'K': 6.57%, 'M': 3.65%, 'F': 8.03%, 'P': 5.11%, 'S': 8.76%, 'T': 8.76%, 'W': 1.46%, 'Y': 2.92%, 'V': 6.57%

Missing Amino Acid(s)

No Amino Acid(s) are missing in this protein

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

D, G, W

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	16093.8 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	81.752	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	54.962	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.118	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.642	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.308	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	6.063	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.343, 0.204, 0.241 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.124	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	16960, 17210	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Francisella tularensis (Gram-negative)

4.2 Antimicrobial Activity

Antimicrobial, Anti-gram-negative

4.3 Enzymatic Activity

4.4 Inhibitory Effect

Protease inhibitor, Thiol protease inhibitor

4.5 Other Biological Activity

Enzyme inhibitor, Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: TÃ¶hÃ¶nen V, Osterlund C, Nordqvist K, et al. Testatin: a cystatin-related gene expressed during early testis development. Proc Natl Acad Sci U S A. 1998;95(24):14208-13. Published 1998 Nov 24. doi:10.1073/pnas.95.24.14208

PMID: 9826679

Citation 2: Carninci P, Kasukawa T, Katayama S, et al. The transcriptional landscape of the mammalian genome. Science. 2005;309(5740):1559-63. Published 2005 Sep 2. doi:10.1126/science.1112014

PMID: 16141072

Citation 3: Church DM, Goodstadt L, Hillier LW, et al. Lineage-specific biology revealed by a finished genome assembly of the mouse. PLoS Biol. 2009;7(5):e1000112. Published 2009 May 5. doi:10.1371/journal.pbio.1000112

PMID: 19468303

Citation 4: Gerhard DS, Wagner L, Feingold EA, et al. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004;14(10B):2121-7. Published 2004 Oct. doi:10.1101/gr.2596504

PMID: 15489334

Citation 5: TÃ¶hÃ¶nen V, Frygelius J, Mohammadieh M, et al. Normal sexual development and fertility in testatin knockout mice. Mol Cell Biol. 2005;25(12):4892-902. Published 2005 Jun. doi:10.1128/MCB.25.12.4892-4902.2005

PMID: 15923608

Citation 6: Eaves-Pyles T, Patel J, Arigi E, et al. Immunomodulatory and antibacterial effects of cystatin 9 against Francisella tularensis. Mol Med. 2013;19(1):263-75. Published 2013 Aug 28. doi:10.2119/molmed.2013.00081

PMID: 23922243

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: Q9Z0H6

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	Y18243	GenBank \|\| EMBL
2.	AB017157	GenBank \|\| EMBL
3.	AK006429	GenBank \|\| EMBL
4.	AL844519	GenBank \|\| EMBL
5.	BC048486	GenBank \|\| EMBL

CCDS: CCDS16850.1

RefSeq: NP_034109.1

5.5 Protein-Protein Interaction Databases

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR043250, IPR000010, IPR046350

PANTHER: PTHR46945

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: ENSGT00940000161877

5.9 Phylogenomic Databases

GeneTree: ENSGT00940000161877

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

Download