AMPDB_1070 | Cecropin-B type 1

PEPTIDE SUMMARY

Cecropin-B type 1

1 General Description

AMPDB ID: AMPDB_1070

Protein Names: Cecropin-B type 1 (Cecropin-B1) [Cleaved into: Cecropin-B (AalCecB); Cecropin-B amidated isoform]

Protein Family: Cecropin family

Gene Name: CECB1 CECB

Source Organism: Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta)

Protein Length: 60 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNFNKLFALVLLIGLVLLTGQTEAGGLKKLGKKLEGVGKRVFKASEKALPVLTGYKAIGK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 5, 'R': 1, 'N': 2, 'D': 0, 'C': 0, 'Q': 1, 'E': 3, 'G': 9, 'H': 0, 'I': 2, 'L': 12, 'K': 10, 'M': 1, 'F': 3, 'P': 1, 'S': 1, 'T': 3, 'W': 0, 'Y': 1, 'V': 5

Frequencies of Amino Acids

'A': 8.33%, 'R': 1.67%, 'N': 3.33%, 'D': 0%, 'C': 0%, 'Q': 1.67%, 'E': 5%, 'G': 15%, 'H': 0%, 'I': 3.33%, 'L': 20%, 'K': 16.67%, 'M': 1.67%, 'F': 5%, 'P': 1.67%, 'S': 1.67%, 'T': 5%, 'W': 0%, 'Y': 1.67%, 'V': 8.33%

Missing Amino Acid(s)

C, D, H, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

M, P, Q, R, S, Y

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6371.79 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	123.5	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	13.535	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.35	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.719	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	10.992	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	8	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.383, 0.217, 0.35 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.067	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	1490, 1490	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

Gram Negative Bacteria and Gram Positive Bacteria

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Sun D, Eccleston ED, Fallon AM, et al. Cloning and expression of three cecropin cDNAs from a mosquito cell line. FEBS Lett. 1999;454(1-2):147-51. Published 1999 Jul 2. doi:10.1016/s0014-5793(99)00799-1

PMID: 10413113

5.2 Protein Sequence Databases

UniProt: Q9Y0Y0

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q9Y0Y0

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AF145803	GenBank \|\| EMBL
2.	AF394747	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR000875, IPR020400

PANTHER: PTHR38329

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download