AMPDB_1067 | Tachystatin-A2

PEPTIDE SUMMARY

Tachystatin-A2

1 General Description

AMPDB ID: AMPDB_1067

Protein Names: Tachystatin-A2

Protein Family: Nil

Gene Name: Nil

Source Organism: Tachypleus tridentatus (Japanese horseshoe crab)

Protein Length: 67 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MKLQNTLILIGCLFLMGAMIGDAYSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 2, 'R': 6, 'N': 2, 'D': 1, 'C': 7, 'Q': 4, 'E': 0, 'G': 8, 'H': 0, 'I': 4, 'L': 8, 'K': 1, 'M': 3, 'F': 3, 'P': 3, 'S': 4, 'T': 4, 'W': 0, 'Y': 5, 'V': 2

Frequencies of Amino Acids

'A': 2.99%, 'R': 8.96%, 'N': 2.99%, 'D': 1.49%, 'C': 10.45%, 'Q': 5.97%, 'E': 0%, 'G': 11.94%, 'H': 0%, 'I': 5.97%, 'L': 11.94%, 'K': 1.49%, 'M': 4.48%, 'F': 4.48%, 'P': 4.48%, 'S': 5.97%, 'T': 5.97%, 'W': 0%, 'Y': 7.46%, 'V': 2.99%

Missing Amino Acid(s)

E, H, W

Most Occurring Amino Acid(s)

G, L

Less Occurring Amino Acid(s)

D, K

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	7510.93 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	81.493	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	32.982	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.24	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.586	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.904	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	5.56	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.328, 0.254, 0.194 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.119	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	7450, 7825	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, E.coli (Gram-negative), P.pastoris, S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Toxin, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Osaki T, Omotezako M, Nagayama R, et al. Horseshoe crab hemocyte-derived antimicrobial polypeptides, tachystatins, with sequence similarity to spider neurotoxins. J Biol Chem. 1999;274(37):26172-8. Published 1999 Sep 10. doi:10.1074/jbc.274.37.26172

PMID: 10473569

Citation 2: Correnti CE, Gewe MM, Mehlin C, et al. Screening, large-scale production and structure-based classification of cystine-dense peptides. Nat Struct Mol Biol. 2018;25(3):270-278. Published 2018 Mar. doi:10.1038/s41594-018-0033-9

PMID: 29483648

Citation 3: Fujitani N, Kawabata S, Osaki T, et al. Structure of the antimicrobial peptide tachystatin A. J Biol Chem. 2002;277(26):23651-7. Published 2002 Jun 28. doi:10.1074/jbc.M111120200

PMID: 11959852

5.2 Protein Sequence Databases

UniProt: Q9U8X3

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q9U8X3

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AB023783	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR022717

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download