AMPDB_1062 | Dermatoxin-B1

PEPTIDE SUMMARY

Dermatoxin-B1

1 General Description

AMPDB ID: AMPDB_1062

Protein Names: Dermatoxin-B1 (DRT-B1) (Dermatoxin)

Protein Family: Frog skin active peptide (FSAP) family; Dermatoxin subfamily

Gene Name: Nil

Source Organism: Phyllomedusa bicolor (Two-colored leaf frog) (Rana bicolor)

Protein Length: 77 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MAFLKKSLFLVLFLGLVPLSLCESEKREGENEEEQEDDQSEEKRSLGSFLKGVGTTLASVGKVVSDQFGKLLQAGQG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 2, 'N': 1, 'D': 3, 'C': 1, 'Q': 5, 'E': 10, 'G': 9, 'H': 0, 'I': 0, 'L': 13, 'K': 7, 'M': 1, 'F': 5, 'P': 1, 'S': 8, 'T': 2, 'W': 0, 'Y': 0, 'V': 6

Frequencies of Amino Acids

'A': 3.9%, 'R': 2.6%, 'N': 1.3%, 'D': 3.9%, 'C': 1.3%, 'Q': 6.49%, 'E': 12.99%, 'G': 11.69%, 'H': 0%, 'I': 0%, 'L': 16.88%, 'K': 9.09%, 'M': 1.3%, 'F': 6.49%, 'P': 1.3%, 'S': 10.39%, 'T': 2.6%, 'W': 0%, 'Y': 0%, 'V': 7.79%

Missing Amino Acid(s)

H, I, W, Y

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

C, M, N, P

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	8377.53 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	92.338	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	52.813	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.226	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.654	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.43	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-4.047	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.312, 0.247, 0.351 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.065	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 0	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

A.laidlawii (Gram-positive), B.cepacia (Gram-negative), B.megaterium, C.glutamicum (Gram-positive), P.aeruginosa (Gram-negative), S.aureus (Gram-positive), S.melliferum (Gram-positive), S.typhimurium

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Anti-mollicute, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Amiche M, Seon AA, Wroblewski H, et al. Isolation of dermatoxin from frog skin, an antibacterial peptide encoded by a novel member of the dermaseptin genes family. Eur J Biochem. 2000;267(14):4583-92. Published 2000 Jul. doi:10.1046/j.1432-1327.2000.01514.x

PMID: 10880984

Citation 2: Amiche M, Ladram A, Nicolas P, et al. A consistent nomenclature of antimicrobial peptides isolated from frogs of the subfamily Phyllomedusinae. Peptides. 2008;29(11):2074-82. Published 2008 Nov. doi:10.1016/j.peptides.2008.06.017

PMID: 18644413

5.2 Protein Sequence Databases

UniProt: Q9PT75

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q9PT75

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ251875	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR004275, IPR016322

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download