AMPDB_1059 | Lantibiotic nukacin

1 General Description

AMPDB ID: AMPDB_1059

Protein Names: Lantibiotic nukacin (Bacteriocin ISK-1)

Protein Family: Type A lantibiotic family

Gene Name: nukA

Source Organism: Staphylococcus warneri

Protein Length: 57 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MENSKVMKDIEVANLLEEVQEDELNEVLGAKKKSGVIPTVSHDCHMNSFQFVFTCCS

FASTA format

Counts of Amino Acids

'A': 2, 'R': 0, 'N': 4, 'D': 3, 'C': 3, 'Q': 2, 'E': 7, 'G': 2, 'H': 2, 'I': 2, 'L': 4, 'K': 5, 'M': 3, 'F': 3, 'P': 1, 'S': 5, 'T': 2, 'W': 0, 'Y': 0, 'V': 7

Frequencies of Amino Acids

'A': 3.51%, 'R': 0%, 'N': 7.02%, 'D': 5.26%, 'C': 5.26%, 'Q': 3.51%, 'E': 12.28%, 'G': 3.51%, 'H': 3.51%, 'I': 3.51%, 'L': 7.02%, 'K': 8.77%, 'M': 5.26%, 'F': 5.26%, 'P': 1.75%, 'S': 8.77%, 'T': 3.51%, 'W': 0%, 'Y': 0%, 'V': 12.28%

Missing Amino Acid(s)

R, W, Y

Most Occurring Amino Acid(s)

E, V

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6403.31 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	80.175	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	30.923	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.191	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.521	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	4.435	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	-4.994	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.281, 0.211, 0.281 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.053	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	0, 125	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

Lactobacillus sakei (Gram-positive), Leuconostoc mesenteroides (Gram-positive), Pediococcus (Gram-positive)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Bacteriocin, Lantibiotic, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Sashihara T, Kimura H, Higuchi T, et al. A novel lantibiotic, nukacin ISK-1, of Staphylococcus warneri ISK-1: cloning of the structural gene and identification of the structure. Biosci Biotechnol Biochem. 2000;64(11):2420-8. Published 2000 Nov. doi:10.1271/bbb.64.2420

PMID: 11193411

Citation 2: Aso Y, Sashihara T, Nagao J, et al. Characterization of a gene cluster of Staphylococcus warneri ISK-1 encoding the biosynthesis of and immunity to the lantibiotic, nukacin ISK-1. Biosci Biotechnol Biochem. 2004;68(8):1663-71. Published 2004 Aug. doi:10.1271/bbb.68.1663

PMID: 15322349

Citation 3: Aso Y, Koga H, Sashihara T, et al. Description of complete DNA sequence of two plasmids from the nukacin ISK-1 producer, Staphylococcus warneri ISK-1. Plasmid. 2005;53(2):164-78. Published 2005 Mar. doi:10.1016/j.plasmid.2004.08.003

PMID: 15737403

Citation 4: Aso Y, Nagao J, Koga H, et al. Heterologous expression and functional analysis of the gene cluster for the biosynthesis of and immunity to the lantibiotic, nukacin ISK-1. J Biosci Bioeng. 2004;98(6):429-36. Published 2004. doi:10.1016/S1389-1723(05)00308-7

PMID: 16233732

Citation 5: Asaduzzaman SM, Nagao J, Aso Y, et al. Lysine-oriented charges trigger the membrane binding and activity of nukacin ISK-1. Appl Environ Microbiol. 2006;72(9):6012-7. Published 2006 Sep. doi:10.1128/AEM.00678-06

PMID: 16957223

5.2 Protein Sequence Databases

5.3 3D Structure Databases

	Sl. no.	PDB ID	Method	Resolution	Access Links	3D View

AlphaFoldDB: Q9KWM4

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AB034941	GenBank \|\| EMBL
2.	AB121757	GenBank \|\| EMBL
3.	AB125341	GenBank \|\| EMBL

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR007682

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download