AMPDB_1054 | Bombinins BLP-7 GH-2

PEPTIDE SUMMARY

Bombinins BLP-7 GH-2

1 General Description

AMPDB ID: AMPDB_1054

Protein Names: Bombinins BLP-7 GH-2 [Cleaved into: Bombinin-like peptide 7 (BLP-7); Bombinin GH-2]

Protein Family: Bombinin family

Gene Name: Nil

Source Organism: Bombina orientalis (Oriental fire-bellied toad)

Protein Length: 144 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

2.1 Sequence

MNFKYIVAVSFLIASTYARSVKNDEQSLSQRDVLEEESLREIRGIGGALLSAGKSALKGLAKGLAEHFANGKRTAEEHEVMKRLEAVMRDLDSLDYPEEASEMETRSFNQEEIANLFTKKEKRILGPVLDLVGRALRGLLKKIG

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 14, 'R': 11, 'N': 5, 'D': 6, 'C': 0, 'Q': 3, 'E': 17, 'G': 11, 'H': 2, 'I': 7, 'L': 19, 'K': 12, 'M': 4, 'F': 5, 'P': 2, 'S': 11, 'T': 4, 'W': 0, 'Y': 3, 'V': 8

Frequencies of Amino Acids

'A': 9.72%, 'R': 7.64%, 'N': 3.47%, 'D': 4.17%, 'C': 0%, 'Q': 2.08%, 'E': 11.81%, 'G': 7.64%, 'H': 1.39%, 'I': 4.86%, 'L': 13.19%, 'K': 8.33%, 'M': 2.78%, 'F': 3.47%, 'P': 1.39%, 'S': 7.64%, 'T': 2.78%, 'W': 0%, 'Y': 2.08%, 'V': 5.56%

Missing Amino Acid(s)

C, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

H, P

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	16053.4 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	96.25	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	44.001	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	-0.349	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.825	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	7.683	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	0.207	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.292, 0.201, 0.375 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.056	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	4470, 4470	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

C.albicans, E.coli (Gram-negative), M.luteus (Gram-negative), P.acnes, S.aureus (Gram-positive), S.cerevisiae

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-candida, Anti-yeast, Anti-gram-negative, Anti-gram-Positive

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Anti-cancer, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Miele R, Borro M, Fiocco D, et al. Sequence of a gene from Bombina orientalis coding for the antimicrobial peptide BLP-7. Peptides. 2000;21(11):1681-6. Published 2000 Nov. doi:10.1016/s0196-9781(00)00317-x

PMID: 11090922

Citation 2: Ke T, Liang S, Huang J, et al. A novel PCR-based method for high throughput prokaryotic expression of antimicrobial peptide genes. BMC Biotechnol. 2012;12:10. Published 2012 Mar 23. doi:10.1186/1472-6750-12-10

PMID: 22439858

Citation 3: Zhou C, Wang Z, Peng X, et al. Discovery of two bombinin peptides with antimicrobial and anticancer activities from the skin secretion of Oriental fire-bellied toad, Bombina orientalis. Chem Biol Drug Des. 2018;91(1):50-61. Published 2018 Jan. doi:10.1111/cbdd.13055

PMID: 28636781

Citation 4: Wu Y, Qiang Y, Cao K, et al. Inhibitory effect of the antimicrobial peptide BLP-7 against Propionibacterium acnes and its anti-inflammatory effect on acne vulgaris. Toxicon. 2020;184:109-115. Published 2020 Sep. doi:10.1016/j.toxicon.2020.06.006

PMID: 32540219

5.2 Protein Sequence Databases

UniProt: Q9DET7

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q9DET7

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AJ298827	GenBank \|\| EMBL

CCDS: Not found

RefSeq: Not found

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR007962

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: Not found

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download