AMPDB_1050 | PYLa PGLa A

1 General Description

AMPDB ID: AMPDB_1050

Protein Names: PYLa PGLa A [Cleaved into: PYLa; PGLa; PGLa-H]

Protein Family: Gastrin cholecystokinin family; Magainin subfamily

Gene Name: pgla-a pyla

Source Organism: Xenopus laevis (African clawed frog)

Protein Length: 64 AA

Protein Existence: Evidence at protein level

2 Protein Sequence & Composition

MYKQIFLCLIIAALCATIMAEASAFADADEDDDKRYVRGMASKAGAIAGKIAKVALKALGRRDS

FASTA format

Counts of Amino Acids

'A': 15, 'R': 4, 'N': 0, 'D': 6, 'C': 2, 'Q': 1, 'E': 2, 'G': 4, 'H': 0, 'I': 6, 'L': 5, 'K': 6, 'M': 3, 'F': 2, 'P': 0, 'S': 3, 'T': 1, 'W': 0, 'Y': 2, 'V': 2

Frequencies of Amino Acids

'A': 23.44%, 'R': 6.25%, 'N': 0%, 'D': 9.38%, 'C': 3.13%, 'Q': 1.56%, 'E': 3.13%, 'G': 6.25%, 'H': 0%, 'I': 9.38%, 'L': 7.81%, 'K': 9.38%, 'M': 4.69%, 'F': 3.13%, 'P': 0%, 'S': 4.69%, 'T': 1.56%, 'W': 0%, 'Y': 3.13%, 'V': 3.13%

Missing Amino Acid(s)

H, N, P, W

Most Occurring Amino Acid(s)

Less Occurring Amino Acid(s)

Q, T

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6809.01 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	99.531	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	31.055	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.273	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.622	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	8.748	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	1.877	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.266, 0.109, 0.391 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.063	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3105	Computed by ProtParam module (biopython 1.79)

4.1 Target Organism(s)

C.albicans, S.aureus (Gram-positive)

4.2 Antimicrobial Activity

Amphibian defense peptide, Antibiotic, Antimicrobial, Fungicide, Anti-MRSA, Anti-candida, Anti-gram-Positive

4.3 Enzymatic Activity

4.4 Inhibitory Effect

4.5 Other Biological Activity

Cytolysis, Hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

Citation 1: Hoffmann W, Richter K, Kreil G, et al. A novel peptide designated PYLa and its precursor as predicted from cloned mRNA of Xenopus laevis skin. EMBO J. 1983;2(5):711-4. Published 1983. doi:10.1002/j.1460-2075.1983.tb01489.x

PMID: 6688991

Citation 2: Kuchler K, Kreil G, Sures I, et al. The genes for the frog skin peptides GLa, xenopsin, levitide and caerulein contain a homologous export exon encoding a signal sequence and part of an amphiphilic peptide. Eur J Biochem. 1989;179(2):281-5. Published 1989 Feb 1. doi:10.1111/j.1432-1033.1989.tb14552.x

PMID: 2465151

Citation 3: Giovannini MG, Poulter L, Gibson BW, et al. Biosynthesis and degradation of peptides derived from Xenopus laevis prohormones. Biochem J. 1987;243(1):113-20. Published 1987 Apr 1. doi:10.1042/bj2430113

PMID: 3606567

Citation 4: Moore KS, Bevins CL, Brasseur MM, et al. Antimicrobial peptides in the stomach of Xenopus laevis. J Biol Chem. 1991;266(29):19851-7. Published 1991 Oct 15. doi:

PMID: 1717472

Citation 5: Hou F, Li J, Pan P, et al. Isolation and characterisation of a new antimicrobial peptide from the skin of Xenopus laevis. Int J Antimicrob Agents. 2011;38(6):510-5. Published 2011 Dec. doi:10.1016/j.ijantimicag.2011.07.012

PMID: 22014884

5.2 Protein Sequence Databases

5.3 3D Structure Databases

AlphaFoldDB: Q99134

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	M12602	GenBank \|\| EMBL
2.	X01824	GenBank \|\| EMBL
3.	X13389	GenBank \|\| EMBL
4.	X13390	GenBank \|\| EMBL
5.	BC170516	GenBank \|\| EMBL
6.	BC170517	GenBank \|\| EMBL

5.5 Protein-Protein Interaction Databases

STRING: Not found

IntAct: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: Not found

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: Not found

KEGG: xla:397770

5.9 Phylogenomic Databases

GeneTree: Not found

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Not found

Download