AMPDB_1047 | Beta-defensin 6

PEPTIDE SUMMARY

Beta-defensin 6

1 General Description

AMPDB ID: AMPDB_1047

Protein Names: Beta-defensin 6 (BD-6) (mBD-6) (Defensin; beta 6)

Protein Family: Beta-defensin family

Gene Name: Defb6

Source Organism: Mus musculus (Mouse)

Protein Length: 63 AA

Protein Existence: Evidence at transcript level

2 Protein Sequence & Composition

2.1 Sequence

MKIHYLLFAFILVMLSPLAAFSQLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK

FASTA format

2.2 Composition

Counts of Amino Acids

'A': 3, 'R': 5, 'N': 2, 'D': 0, 'C': 6, 'Q': 2, 'E': 0, 'G': 7, 'H': 3, 'I': 4, 'L': 7, 'K': 3, 'M': 3, 'F': 4, 'P': 3, 'S': 6, 'T': 1, 'W': 0, 'Y': 2, 'V': 2

Frequencies of Amino Acids

'A': 4.76%, 'R': 7.94%, 'N': 3.17%, 'D': 0%, 'C': 9.52%, 'Q': 3.17%, 'E': 0%, 'G': 11.11%, 'H': 4.76%, 'I': 6.35%, 'L': 11.11%, 'K': 4.76%, 'M': 4.76%, 'F': 6.35%, 'P': 4.76%, 'S': 9.52%, 'T': 1.59%, 'W': 0%, 'Y': 3.17%, 'V': 3.17%

Missing Amino Acid(s)

D, E, W

Most Occurring Amino Acid(s)

G, L

Less Occurring Amino Acid(s)

Hydrophobic Amino Acid(s) Count

Hydrophilic Amino Acid(s) Count

Basic Amino Acid(s) Count

Acidic Amino Acid(s) Count

Modified Amino Acid(s) Count

Modified Amino Acid(s) Frequencies

Computed by biopython (version 1.79) & proteinAnalysis (version 1)

3 Physicochemical Properties

Sl. No.	Properties	Values	Reference
1.	Molecular Mass	6977.38 Da	Computed by ProtParam module (biopython 1.79)
2.	Aliphatic Index	82.064	Computed by ProtParam module (biopython 1.79)
3.	Instability Index (Half Life)	76.906	Computed by ProtParam module (biopython 1.79)
4.	Hydrophobicity (GRAVY)	0.267	Computed by ProtParam module (biopython 1.79)
5.	Hydrophobic Moment	0.623	Computed by ProtParam module (biopython 1.79)
6.	Isoelectric Point	9.964	Computed by ProtParam module (biopython 1.79)
7.	Charge (at pH 7)	7.896	Computed by ProtParam module (biopython 1.79)
8.	Secondary Structure Fraction	0.302, 0.286, 0.206 [Helix, Turn, Sheet]	Computed by ProtParam module (biopython 1.79)
9.	Aromaticity	0.095	Computed by ProtParam module (biopython 1.79)
10.	Molar Extinction Coefficient (cysteine\|cystine)	2980, 3355	Computed by ProtParam module (biopython 1.79)

4 Activity Details

4.1 Target Organism(s)

E.coli (Gram-negative)

4.2 Antimicrobial Activity

Antibiotic, Antimicrobial, Defensin, Anti-gram-negative

4.3 Enzymatic Activity

Not found

4.4 Inhibitory Effect

Not found

4.5 Other Biological Activity

Non-hemolytic, Non-ribosomal

Activity data manually curated from Literature and UniProt

5 Database Cross-references

5.1 Literature Database

5.1.1 PubMed

Citation 1: Yamaguchi Y, Fukuhara S, Nagase T, et al. A novel mouse beta-defensin, mBD-6, predominantly expressed in skeletal muscle. J Biol Chem. 2001;276(34):31510-4. Published 2001 Aug 24. doi:10.1074/jbc.M104149200

PMID: 11408484

5.2 Protein Sequence Databases

UniProt: Q91VD6

5.3 3D Structure Databases

No PDB Ids found

AlphaFoldDB: Q91VD6

5.4 Nucleotide Sequence Databases

Sl. no.	Accession(s)	Access Link(s)
1.	AB063110	GenBank \|\| EMBL
2.	AB063109	GenBank \|\| EMBL

CCDS: CCDS40255.1

RefSeq: NP_473415.1

5.5 Protein-Protein Interaction Databases

STRING: 10090.ENSMUSP00000060836

IntAct: Not found

MINT: Not found

DIP: Not found

BioGRID: Not found

5.6 Ligand Databases

BindingDB: Not found

DrugBank: Not found

ChEMBL: Not found

5.7 Family & Domain Databases

InterPro: IPR001855

PANTHER: Not found

PROSITE: Not found

5.8 Genome Annotation Databases

Ensembl: ENSGT01030000235924

KEGG: mmu:116746

5.9 Phylogenomic Databases

GeneTree: ENSGT01030000235924

5.10 Enzyme & Pathway Databases

BRENDA: Not found

BioCyc: Not found

5.11 Protein-RNA Interaction Databases

RNAct: Q91VD6

Download